Cosori FYI Tip... Just in case you haven't discovered it yet, you can do the Saute/Brown as recommended here by pressing the adjust button to get to 302 degrees. I discovered quite by accident that you can get to 320 degrees if you press the Saute/Brown button followed by pressing the Pressure/Temp button (next to Adjust) immediately followed by the + button (next to Pressure/Temp) to increase up to 320 degrees. You have the same option with the warm function. After cooking has finished & it auto goes to warm, press the cancel button. Then press the Warm button followed by Pressure/Temp button immediately followed by the + button. I live alone & back during Winter when the ground was covered in snow, I'd make a pot of Soup/Stew. The default Warm wasn't warm enough; but after discovering that I could increase the temp, I'd up it so my soup stayed warmer/hot for most of the day & I more or less grazed my soup off & on all day. Found it a good way to stay warm & safer than having to go outside. I've found this useful with several of my recipes but not so important in others. Just sharing!!!

This is my new favorite kitchen tool! Day 1 I was going to pressure cook a meat kzread.infoUgkxG-7WiT7ocumjytOpHDFt632PL0pxXRAg and potato stew, decided I wouldn't eat it that night so I went with a slow cook so I could go to bed and put it away in the morning. I love that versatility! The sauté feature works great and adds tons of extra flavor to dishes, and I can easily sizzle meats in the bottom then deglaze for some restaurant worthy flavors.Big bonus - you can cook a whole frozen chicken in about 2 hours. Amazing! I've seen a couple videos, haven't tried it yet, but I will soon!

I do this whole chicken but instead of a trivet I halve medium potatoes and place them cut side down, or I use roughly chopped carrots celery and sweet onion. When done they can be tossed or actually eaten. I prefer to mash the tatoes with some lemmon pepper and butter, and puree the very well cooked vegies and broth in to a chicken gravy. When cooling the whole chicken I cook them breast down. This actually increases the jiuces in the breast and they never come out dry. (I learned this from my Grams for Thanksgiving Turkeys)

@gramgramme8310

6 жыл бұрын

Stewart Perthou carefully loosen the skin on the breast before you cook it and put your seasonings Under the Skin right on the beat that increases the flavor to the chicken

@SpiritBear12

5 жыл бұрын

My sister one Thanksgiving was feeling a little rushed and she accidentally put the turkey in the roaster breast side down. No one noticed until it was done. She felt embarrassed, but after we flipped it over to carve it we found that the breast meat came out nicer than it does when you cook it right side up! I'm not much for the white meat myself because it's usually dryer than the car meat. I also think it has less flavor. But this time it was pretty darn good!

@MusicforMe123

5 жыл бұрын

That is a fantastic idea, thanks for sharing.

@darcywliu3108

5 жыл бұрын

i

@msoda8516

5 жыл бұрын

Stewart Perthou That’s how my granny thought me

Thank you so much for this video! I just got an instant pot and after reading the instructions, got the impression all meat had to be cooked like a stew. This looks so much better! You've opened my eyes

I made this into a complete meal by adding baby potatoes, carrots and celery,onion on the bottom of the cooker and to the sides around the chicken. I added 1 1/2 cups water. The chicken and the veggies did release tons of tasty juices-yummy broth. I used Cosori cooker.

@blondebailey9575

5 жыл бұрын

I cook my whole chicken exactly the same way except with broth and no celery. Oh, and in my Crockpot instead. It's a wonderfully tasty dinner! And extremely juicy in the slow cooker! I'm planning to buy the Instapot and look forward to trying it with the pressure cooker method instead when I don't have the time to do it the other way. Yum! P.S. sometimes I also add green beans in the pot. P.S.S. I love the puppy avatar!

Positive comments only...this is to show people who want to cook this way because we are in a van or small rv or are a senior like myself unable to just hop to a major grocery store...this provides the information we are looking for....if this isn’t your “thing” that’s fine, but no need to be negative, she put a lot of work into giving us the answers WE want. Thanks for the great video

@eliz964

5 жыл бұрын

@Lloyd Bonafide Why do you have to be like that? If you don't want to cook a chicken via pressure cooker, then why are you even on this video?

@romuloromero2268

5 жыл бұрын

Well said

@kia4020

5 жыл бұрын

Valerie King no 1 could’ve expressed that better!!!!!

@blondebailey9575

5 жыл бұрын

Great point! My husband and I spend a great deal of time in our rv and being able to cook a nice meal in just one pot is quite handy. It's also a great method for cooking when it's 118 degrees outside! Who wants to have added heat in the kitchen? I haven't bought an InstaPot yet (I only recently discovered this here on KZread) but certainly plan to. In the meantime I'm watching numerous videos on what to cook. 👍I like how this will also replace my Crockpot and give me a pressure cooker, saute pan, bake pan, etc.. I'm so looking forward to buying this! As for negative comments I never understand the need of others to bother. I prefer to live by the old adage "If you have nothing nice to say then say nothing at all". It's good for the soul.

@zaphnathpaaneah3108

4 жыл бұрын

Haters keep scrolling shoo be gone!

I got a Cosori as a gift from my mom and later found out about instant pots, even though they seem to be more popular. I always wondered what the big difference was, so thanks for doing this video!

I have a 6qt. instant pot and a 8qt cosori, and I love them both. Glad you did this video.

THANK YOU! You have gained a new follower. Just bought a 6qt Instapot yesterday. I was reluctant to use it because it seemed overwhelming, but your videos make it supper simple and easy to follow. Now I feel like I can get my food prep started for my workouts and work week. I plan to follow your tips and recipe ideas. Keep up the great work and thanks again! 🙌🏾✨

If you don't want to use a trivet (like me) I just throw in some potatoes or carrots and the chook sits on them. Then you have some veges cooked in the broth/juice at the end as well :-)

Nice comparison. I have The Instapot and love it. Even more so now as I see it’s a bit easier to use in terms of steps.

If you don't have a trivet you can use celery stalks and sliced onion to keep the chicken off of the bottom

@MsBettyRubble

5 жыл бұрын

Great tip! Thanks for that.

@yootoob4516

4 жыл бұрын

Restaurants frequently use parts of vegetables that are thrown away -- onion and garlic skins, kale stalks, carrot tops, celery ends and butt. When prepping veggies, throw the trim into a plastic bag in the freezer -- it'll flavor the stock, too!

Thank you for doing this comparison video, I have two Instant Pots and really enjoy using them, but good to know there are other choices!🌷

The instant pot is great if you have a small kitchen with no ventilation. Doesn't get hot in there, has the heat contained. The only thing different I would add is while the chicken is out of the pot after browning, add your spices then before putting back into the instant pot. Beef stew is done in minutes and tender, even cheesecake is perfect. Sweet potatoes or whole potatoes take minutes. Cook up as many as will fit in pot and have cooked potatoes on the ready for the week.

Thank you for an amazingly concise and informative video, I really appreciated how complete it was. Minutes per pound rule of thumb, hint on saving left over liquids, and showing both units side by side to see their similarities and differences really helped me understand my own machine a bit more. Again, thank you!

My instant pot arrives tomorrow. After watching this video I just can't wait! Thank you for making this video it was very informative & makes me feel really excited about cooking flavorful chicken quickly!

I can almost smell that chicken! Thanks for the comprehensive video. I have an organic chicken which will go into the instant pot tomorrow!

I was so happy with my 8qt IP that I bought a 6qt IP.. I am just in love with both of them!

@willybilly99

5 жыл бұрын

but can you cook?

@yootoob4516

4 жыл бұрын

I haven't done my research yet, but can the IP also function as a slow cooker?

That was a GREAT video, Indigo Nili, because my wife just ordered the Instapot, and I had asked her if I could cook a whole chicken with it. All the other info I read didn't say. Thank you so much. I had been buying roast chicken at the supermarket, but it's quite a bit more expensive than cooking your own, plus you don't know how long it's been sitting under a heat lamp. The market did tell me, however, that they put the cooked chickens under the lamp at about 10 AM. If you buy it at 4 PM, that chicken's been under the lamp for 6 hours.

I found this video informative, to the point, no wasted words, a pleasure to watch.

I just ordered my instant pot in red today,I can’t wait until my Come next week,I read so many great reviews on this pot

I think it's annoying how some people are commenting that they like oven cooked chicken better you're missing the point. I was searching for someone who cooked a whole chicken in an IP so I can cook in my RV which doesn't have an oven. For those of you who think that this is a inferior way of cooking, I'm waiting for your video on how you do it.

@RedfishInc

5 жыл бұрын

Rotisserie baby!!!! But if this is all you have it's better than nothing.

@robertspivey46

5 жыл бұрын

Kim, I to live in the a rev. But I do have an oven but I don’t use it at all. Nuwave oven is what I use.

@ham3749

5 жыл бұрын

I got an Instant pot as a gift and i look for videos on how to use it. Im still getting used to it and am not using it as much as i would like to!

@bradleyr34

5 жыл бұрын

H&AM, I just got one as gift too. I have been using a 40 year old pressure cooker. It’s being retired with full honors. The equally old Original Crock Pot is next!

@ham3749

5 жыл бұрын

@@bradleyr34 I do like the IP, I just need to take the time to learn it lol. I love my crockpot though too! The only way I will cook a spiral ham is in my crock pot!

Thanks for this. As someone new to cooking and also new to using an instant pot, this was helpful. It takes the intimidation out of cooking a whole chicken.

Great to see how versatile the Instant Pot is!

Great comparison! I love my instant pot! And I have learned so much from you! Thanks you! I love catching a glance and your baby Levi bump! So exciting!

Good job! Video very well done👍🏾 It’s rare for me to hang out on a vid for a whole 11 minutes 😋

Thank you for the side-by-side. This was very helpful. Aesthetically, I like the look of the Cosori better. For me, the Cosori provided better display feedback with the temperature reading and the progress circle as it came up to pressure. I like dark meat and cook thighs or leg quarters -- usually in the oven. This looks like a much more tender and less messy method, as well as saving energy -- oven method takes 45 minutes.

It's about $69, on Amazon, for the Instant Pot 6 qt and about $80, on Amazon,for the Cosori 6 qt. I'm glad I got the Instant Pot now. It looks really good...I usually bake mine in an older covered pan in the oven...I like it falling apart...just me...but, I could increase the time with my Instant Pot to achieve the same results. Thanks for the comparison too!! Great job!

TIP: Today I put leftover cornbread (from a couple days ago) that was dried out, into the Instant Pot in a steamer basket with 1 cup of water in the bottom of the vessel, and put on manual setting for zero minutes, and did a Q.R. The cornbread came out hot and moist just as if I had baked it fresh in the oven. I'm going to try this in future with bread, cake, etc.

@baddestjoanna-michellesmit5578

Жыл бұрын

Intresting but I can concur

I got an Instant Pot for Christmas. Love it.

Excellent presentation, Indigo! Well-presented, clear, easily understood, excellent comparison of the two appliances. Thank you for sharing your time and expertise.

I’ve got a 3yr old Cosori. Works just fine - at this point would probably go IP just because there are so many people who own it so a larger community to share cooking tips with. They would work fine on both but it saves you having to do any translation of terms/settings.

My kids got me an instapot for Christmas so I'm learning some great things here. Thanks so much! :)Jen

I got a Cosori for my birthday. I told my husband i wanted an Instand Pot, he didn't know it was a brand! But that's ok, I love it. I didn't know you could raise the temperature on the saute' function!

Interesting video, thanks. A lot of contention in comments about the cooking temperature. I've used an Instant Pot for a couple of years for various things, and the recommended cooking times have always been too long to retain texture and flavour. The minimum safe temperature for chicken cooking is 65C (150F), and I reckon that you'd reach that temperature after about 15 minutes for a chicken of the size shown. You may wish it cooked a bit longer, or browned in the oven - and to retain the shape of the chicken browning it at the end in a very hot oven is a good way to go rather than at the start. Today I have cooked some beef cheek for a casserole in this pressure cooker. After 14 minutes this very tough cut is transformed into a delight, but with some texture rather than just sogginess. I have to say that before I purchased an electric pressure cooker I regarded the whole thing with great suspicion, but I am a bit of a convert.

To those who say you don't need an Instant Pot, I thought the same thing. I received one as a gift. I love it!!!!!! Especially for meat and bone broth. Doesn't matter what kind of mean, unless you are grilling for that grill taste, Instant Pot it!!

@trazyntheinfinite9895

5 ай бұрын

You can use saute mode to brown a nice slab of meat....

Thank you so much for sharing this video, just purchased the Instant Pot and am looking forward to cooking some great meals! Thanks again!

I’ve ordered Instant pot, can’t wait until I get it👍🏻

Thank you for doing this video. I just purchased mine this morning and am looking forward to learning all the options I can use to cook meals. I am so excited!

Just learning to use an electric pot. Thank you for all of your info.

Great tip on using canning lids as a trivet!

@blondebailey9575

5 жыл бұрын

I thought so too!

I've used instant pot for a while now and I will say it is a great device, however, I am also saying that for best cooking, depending on what is being cooked, the oven can still offer great traditional cooking. there are times when you may want to use both, Instant pot for the majority, oven to crisp the skin, if you enjoy crisp skin,. But over all, I am using the Instant pot for most of what I used the oven for. Admittedly, using the oven can be a better option when cooking larger portions which the IP cannot handle. any method of cooking is a good method as long as you cooking fresh and get away from all that fast food garbage out there.

I've been wanting to buy an InstantPot, but wasn't sure how a baked chicken would turn out. Thank you for sharing.

EXCELLENT REVIEW AND VIDEO AND RECIPE!!!! Thank you so much for showing in depth the two pressure cookers cooking a whole chicken, brilliant. I have the Instant Pot 6 quart and I have only done one chicken so far and it was ok good. But your browning and seasoning sound wonderful. I find you so amazing and can't help but wonder how you manage all of this with your wonderful children. Guess you are a true wonder woman. Thanks so much Nili, loved it and can't wait to cook me a whole chicken now. Many hugs to you. Claudia

Thank you kindly for making this video. I'd been thinking about buying an instant pot and was curious.

So many haters here! Thanks for the nice videos. People don't seem to get that if you're a busy person, you don't really have time to really bake a chicken properly (internal temperature). This is a nice technique because you literally can set it on the insta pot and run to the store, or go play outside with your kids, you don't need to run back and take the chicken out of the oven. I like to submerge mine in liquid, so then I get poached chicken that I can use for many many things (tacos, nachos, etc) and on top of that I get yummy stock. thanks again!

Great demo. I'm so glad you mentioned the size chickens you used.

I LOVE Chosen Foods Avocado Oil. It's the best. I use it to make mayo and it's delish.

Just what I was looking for. Very well explained, super easy to understand. Thanks so much for your excellent video.

Thanks for sharing the two side by side and I Learned something new as well,not to quick release meat. I did a boston butt and did quick release and maby that is why I thought it want quite as tender as slow cooker but it was good. Thanks for that tip.

@najwaabdul-tawwab3592

5 жыл бұрын

Standing rib eye roast

Unless I’m mistaken, it looks like the instant pot was not quite up to temp when you started searing. I’ve done the exact same thing. Thank you for the video.

Finally! Cooking instant pot without using oven, browsing before cooking is great. So many of these use oven after cooking. I don’t have an oven in my RV this was so helpful.

@shantrellyasharahla5528

4 жыл бұрын

Hello! What size pots are those? I was wondering your opinion on 8qt do you think it would be better or not so much?

@IndigoNili

4 жыл бұрын

The 8qt is great for cooking for a lot of people or big batch cooking! As long as you have the space it's a great option!

Thanks for sharing...Wow amazing knife skills on cutting those chickens apart...ignore idiots making negative comments, I like to see them making a video this good. 👍👍

I'll continue to support instant pot. I watched a story about the guy who started the company, who was also the original engineer. It really was an inspirational story. The other people have just copied his idea.

@lindasegraves6207

4 жыл бұрын

Not True. I have been cooking with digital pressure cooker since early 1990's. Instant pot wasn't on the market then. I also have used a stovetop pressure cooker since 1971. I am not saying the IP isn't a great pot just not the first and was copied.

@seasonedsofisticate1901

4 жыл бұрын

Pressure cookers have been around for YEARS way before Instant Pot. This guy just came up with a name that seemed to hav3 caught on and some fairly good marketing.

@seasonedsofisticate1901

4 жыл бұрын

Linda Segraves exactly!

@Pattys1967

4 жыл бұрын

@@lindasegraves6207 i gree,my hubby heard me mention that i really wanted an instant pot,so what does he do? he goes out and buys me a bella 8 quart 10 in 1 pressure cooker/slow cooker and i was like,what the hell is this? to myself lol but anyways,i knew he was just trying to make me happy and so,i cooked my first ever dinner in my bella,it was a pot roast,and let me tell you,it was the best ,yummiest pot roast we have ever had,so from there and almost every day,i used my bella,yesterday my son bought me an instant pot duo nova 8 quart,i noticed on it that im gonna have to learn all over again how to use it lol my bella has a non stick pan,never got a burn notice,long story short,it doesnt have to be instant pot brand to get a good result,i know i love my bella and its cheaper,just thought id say this lol hope you didnt mind,you are totally right

@HotSixty

4 жыл бұрын

Linda Segraves Totally agree. I’m 66yrs. Remember my mom had one in the seventies

Loved the comparison video. I was seeing the cosori around lately. Wondered how it held up to IP. I have the 6qt IP and love it. Thanks again for another great video!

I have never done a chicken in the instant pot, but now that I see how easy it is, I am wondering why not! Thanks for this helpful video.

I jus bought my first instant pot I can with to try this chicken thank you for sharing 😋😊

Enjoyed your vid very much, your voice and detail to explain the proscess of your demonstration, made it easy for me to follow you. 👍😁

@user-dt5vx8hq6h

3 жыл бұрын

AASDFGHVBMKKHGFWERBBMKHGFEERVNMMGGFBMMGGRR SDDBMFDSERVNMKHGFREWVNMFDSSRRVNMHGRRBNMKHGFDERVNMGFSERFVNMIKGGRREEVBNM

I love using the pressure cooker, like I said yesterday, it keeps from heating up my house here in the desert. I live in Arizona if you're wondering. My fav thing to cook in it is my soups. I Love a good soup and make quite a few in the wintertime.

Bad news is I blew through 3 Cosori 8qt from Amazon in 2 months due to electronic failures. Good news is each time Amazon refunded them and I threw out the units, I kept the stainless liners. They fit my instant pot brand cooker. I'll not own a competing brand again, as my original second hand 6qt IP from 6 years ago is still going strong.

i just discovered your video because I had bought an Instapot recently and was looking at recipies of things I could cook for dinner for my wife and I. The chicken looks wonderful and we both liked the look of the Instantpot chicken best. So I looked to see if you had the ingredients you used for your spices , which you did, thank you! And we discovered we are practically neighbors!!! Small world! Happy Valley here. Thanks for posting your video's! I am by NO means or dreams a good cook, but since I was able to retire before my wife, who is still working, I thought the least I could do is try to have something good ready for her when she gets home as she is working long days and is hungry when she gets home! I stumbled on the instantpot at Costco, interesting story as I was not there to buy one, but having recently visited my sister and family in Prineville OR they were all saying how much they LOVED the Instantpot, so a woman checking out in front of me had only 1 item, the instantpot, so I asked her is it really that good and she was saying OHHH YES and today it is on sale for the last day at costco for only $75 dollars, so I couldn't leave without one. LOL Just read Lloyd Bonafide's recipe for chicken, how funny because that has been my recipe for years now! We'll see how it goes with me cooking things wish me luck!

@IndigoNili

5 жыл бұрын

Hey neighbor! We love going to Happy Valley! I hope you enjoy your new instant pot. How wonderful that your able to cook nice meals for your wife. I love that!

@matthewronson5218

5 жыл бұрын

For apx. $16.00 less you could have had an 8-1 cooker instead of a $75.00 Instant Pot 7-1. YOu should have left without one.

@donc9751

5 жыл бұрын

@@matthewronson5218 Its perfect for me actually, no matter what the other could do. The other may be better, but I never buy cooking things and only this because my sisters loved it and and that's all the info I had to go on, so that's good enough for me. If I hadnt bought this I'd of never bought anything so I'm totally content with what I bought. Others that know more about cooking and cook more than I do, such as you for example, it may not have been the best choice, I'm not experienced enough to know, and never will be. Everything I've cooked so far has come out perfect so I'm a happy camper. Thanks for the info though maybe it will help someone make a better decision for themselves.

@matthewronson5218

5 жыл бұрын

@@donc9751 The other one the same thing, plus one, but whatever works for you is best.

Great video, very concise and loaded with great info!

The chickens look great when cooked in both of those pots and I have yet to use it. I took it out of it's box, but have not put it to use yet since I have not been doing any major cooking where the cooker would be better at doing it in. I love how you did the tests and showed impartiality in doing so. After viewing the results of one pressure cooker by this one lady and she showed how the non-stick coating inside that cooker and I would not want that cooker since it has a defect in the material used. I have had skillets which did the same thing and I won't buy another one due to that defect.

Thanks for the test. Which one to buy? I would go for the Cosori because it looks more expensive and I like the sound it makes. But the IP seems to be a bit easier to use (and faster). Cheers

I've had a 6qt for a while now and just got my 8qt instant pot for Christmas. Love them both. I wanted one for main dish and one for sides so I could do both at the same time. I think you should do a tutorial on how to carve a chicken if you don't already have one.

@maryjanewilson7425

6 жыл бұрын

I’m

Cool! You did a SCIENCE!!! Loved the comparison and diligence you performed, to be fair to both units, Nili. Looks like it's down to personal preference at this point! Thanks!

Thank you for the video, it was helpful - especially on the Cosori unit. I realize pressure cooking maintains more of the meat moisture along with the natural depressurizing, but 180* seems a little overcooked. If the mfr suggests 6 minutes per pound poultry and you allow a natural cool down, should that time be adjusted to maybe 4 or 5 minutes per pound to achieve something closer to 165*? I've never tried to "roast" a chicken in my pressure cookers because of this...

Nice video! Thank you! I wish you had given us a close up shot of the button panels. Plus mention the prices of those two pots. Thanks.

I love making chicken gravy with the drippings. I just use corn starch to thicken

@YvetteArby

3 жыл бұрын

Thanks for this tip! I love gravy with my chicken! ✌🏼💖😺

Excellent side by side!!!! Thank You!!! I have two sizes of Cosori. Indoor Chikin kookin at is best, moist, tender, quick, easy cleanup!!! 20 stars!!

Loved this. I’m having the hardest time. However, I had different brand and my other brand everything burned. So frustrating lol. Do you have a roast? Also, I’m having a hard time set timing how much liquids I need in foods.

Instant Pot, has been my large scale protein cooking source for 2 yrs and I have yet to cook a whole chicken in one... will be doing so this weekend... thanks for the detailed video!! I expected to see the chickens fall apart like slowcooker does... the amount of added liquid and trivet are crucial, pleasantly surprised they stayed intact!! 😊😊

So thorough you could have earned a PhD on this presentation. Thanks for your time and quality content!

Got an IP for Christmas and this video def made me more inclined to make a whole chicken. Ignore the useless commenters! Some people enjoy making their own food. Hubs and I cook together, as we feel it adds another closeness and just hopping into the car to simply buy a cooked chicken doesnt cut it.

My Ronco rotisserie oven kicks butt on both of those pots.

Love the comparisons. Thank you for the video. Btw, I noticed you have Instant Pot Mini accessories on Amazon. Do you have a Mini too?

Thanks, what was the price difference between the two?

Could you remove the Cosori trivet handle, turn the trivet upside down and put the chicken on it using the tripod legs as handles? Just a thought. ;)

@yootoob4516

4 жыл бұрын

Your suggestion is simple and brilliant! I'd like to add: if one removes the handle, screw the nut onto it, so it doesn't get lost!

I bought a vertical chicken roasting stand for this purpose. I have the 8 qt. Instant Pot.

I did this with a stove top pressure cooker and it came out divine! Thanks for the recipe.😘

Hi! How do I find your Amazon list. I was looking for something you used in a previous video. The silicone baking supplies. Thanks!

@IndigoNili

6 жыл бұрын

Here it is! www.amazon.com/shop/indigonili

@monicangari4613

3 жыл бұрын

P

Great video! I just tried making a whole chicken too, but with the Emeril Lagasse pressure cooker (and I have a video about it on my channel). Can't wait to see where the future of pressure cookers takes us! :P

I use plain Dutch oven on stove top.Well season chicken. Put on lid Cook on low.Cooks in its own juices. Rotate pieces once or twice. done in 90 minutes. Tender juicy.

Trying to sync the cookers is a bit complicated, but they can both be set to cook equally but with a lag time between to allow you to work on the chickens at the different stages.

Very well done, factual comparison.

Thanks , I got new IP and first thing I want to make is whole chicken !! U made it easy , thanks again, I follow u from faraway all the way from Egypt. Lool , شكرا

This video came up in my feed as I am I new IP user and I found this very helpful thanks for sharing!😁,

One other spice I would suggest is Rosemary. other than that, you got the right idea for simple to apply great flavours. put the broth into an ice cube tray and voila, instant stock cubes for future recipes. yum yum.

I have a 5 quart instant pot and I love it... thanks for the video

@blackhatter011

5 жыл бұрын

I have a 6 quart instant pot and I love it even more... thanks for the video

@ServingUpSarcasm

4 жыл бұрын

@@blackhatter011 i have a 7 quart instant pot and i love her

@blackhatter011

4 жыл бұрын

@@ServingUpSarcasm Oh yea, well I just bought an 8 quart instant pot and I love it even more than my six quart.

@zarax5029

3 жыл бұрын

@@blackhatter011 Well I have a 200-quart and I simply adore it so there's that.

@blackhatter011

3 жыл бұрын

@@zarax5029 I just bought the new 600 quart into the pot and I simply adore it.

I loved the early part of the video--have you considered working as a hand model? (You also qualify as an honorary Italian with those flourishes!)

Excellent you teach the best using both pressure pot i have a corsori 6qt ans i will do my turkey in mines thanx ...

If you are getting a pressure cooker to use as an all in one appliance. You should also consider getting an air fryer lid that fits it. You can crisp up the skin on the chicken with the air fryer lid after pressure cooking it. (I would pour off the juices first). Not to mention you can cook up any air fryer recipes too. I love my instant pot, I never had such easy to peel hard cooked eggs, or able to cook foods from frozen in less time than it took to thaw them before.

I would use chicken stock not water. Put onions, carrots, celery, and garlic in the bottom. I would not brown the bird. After cooking I would dry they outside of the bird, brush the outside with butter, and then roast it for a couple of minutes.

@plastamasta5096

5 жыл бұрын

Guess youre a pro. All hail the chicken god

@DCFunBud

5 жыл бұрын

@@plastamasta5096 Low self image?

@plastamasta5096

5 жыл бұрын

@@DCFunBud no you have a high 'self image' stop preaching your shit on someone elses channel. Type is cheap chicken god

@rain-wanders

5 жыл бұрын

@@plastamasta5096 Dude why are you so butt hurt that someone said another way to cook a chicken? BTW DCFunBud, that's how I cook mine as well.

@plastamasta5096

5 жыл бұрын

@@rain-wanderswhat the cluck

thanks for all your hard work in putting this video together, my wife and i are in the market for the instapot we both work full time and no children both chickens look awesome looking and basically look the same i look forward to watching more of your videos, when you cook your own chicken from scratch you know what your getting when i get an infection i just go to Costco, i here the chickens there already have the antibiotics in them.

I still can’t make my mind up if to get one of these pots it’s storing it I suppose if it slow cooks I get rid of the slow cooker . I keep seeing chicken recipes what’s it like for roast beef ?

I noticed the Cosori gives the cooking temp when the Instant pot only says HOT You think you could spice the chickens outside thhe pot? Might be a little easier.

I've been having a hard time finding a chicken under 6 pounds (unless you want to pay for organic). Tyson chickens are ridiculously huge. Hormones?

@thatguythatdoesstuff7448

3 жыл бұрын

Yep, hormones most likely. And the feed. -- A dedicated Butcher shop often gets the chickens from small local farms rather than mass production operations like Tyson. And good Butchers are forthright about where the chickens come from.

I think the Casori's looks better browned by its sautee feature than the instant pot. Good job!

Very informative video...been thinking about this exact use of the product to see if I should buy one...Good use of the touch pads to thanks

This was a very informative cook video! Thank you so much! Nice job😃👍🏻