“You’re going down” “Sorry, all outta mercy” Brilliant writing

@allighast9714

Жыл бұрын

It's like they wrote both lines expecting them to choose one for the final draft and then they just gave it to the other car instead

@Dennis_Reynolds

Жыл бұрын

Shakespearean levels of writing.

@graememontrose1741

Жыл бұрын

Yeah, for the latter i woulda gone with "I am the Spirit of Vengeance...don't ask me for mercy."

@LegacyKnight-zm6vz

Жыл бұрын

Gressil: Have mercy Ghost Rider: Didn’t say “please”. Maybe not the best, but better IMO lol

@BigBoss-dt4jv

Жыл бұрын

Didn"t knew the Rider should be so eloquent...

No CGI just real life scenes captured by cameras. Nicolas cage is a legend

@jeremygray462

Жыл бұрын

always

@jasonabraham6061

Жыл бұрын

He really is every movie especially those thrillers are so good

@cre7701

Жыл бұрын

@@kronos4669 tu chu h ..sarcasm tha uska comment

@blarginsnitchal

Жыл бұрын

@@epicawesome5464 More!!

@TheBlueShark

Жыл бұрын

Can't believe Nicholas Cage actually had to burn all his skin and organs off just for this role

Anyone watching in 2024?

@jesuranjesu3708

16 күн бұрын

Yes sit🥷

@KaranKumar-wm1il

15 күн бұрын

Yes lot of people are watching this video in 2024

@MusicOfficial-pg3lw

15 күн бұрын

Ayooo

@inc7892

15 күн бұрын

Hell 🥵🥵Yeah

@HarisKhan-nw7hl

15 күн бұрын

No im from 1673

"He ain't so tough" gets hit with one punch n says have mercy 😂😂💀

@thanhaislam1810

3 ай бұрын

😡😡

@AMETHYST21897

2 ай бұрын

“Sorry. All out of mercy.”

@dude-jk2hn

2 ай бұрын

But how did GR survive that truck?

@AMETHYST21897

Ай бұрын

@@dude-jk2hn when you think real hard about it the Ghost Rider is actually a spirit. Perhaps its hellish powers allowed it (and by extension, Johnny Blaze) to survive the truck crash unharmed ?

@mirandaalifkarim3420

Ай бұрын

Ghost Riders can t be k illed by anything exc ept holy weapons

3:39 As a Biker I can confirm that this is what it feels like to go for the first ride after winter break :D

@gumballer133

Жыл бұрын

That's how I feel every year when I get on my Turbo 2 stroke snowmobile again. Haha.

@amitthapliyal9787

Жыл бұрын

U really had winter break...its just oosome feeling riding in winter in hills with sunshine...

@trevorsawyer2272

Жыл бұрын

It does it so does

@aamirhoda7363

Жыл бұрын

Damn yeahhh 🔥🔥🔥🔥

@COMEDIC_EDDIE

Жыл бұрын

Hahaha...every day after work

Say what you want about this movie, but Nic cage killed it in this role. Especially this first transformation scene. Epic !

@BonifaceJoseph

Жыл бұрын

LMAO, No.....its a shit movie

@Philip_023

Жыл бұрын

Yeah... One of the best adaptations from Marvel

@jeremygray462

Жыл бұрын

@@BonifaceJoseph what r u for real

@greatninja2590

Жыл бұрын

@Most Heinous Gamer ! nah it is a bad film acting was okay would have benefit with competent writer though.

@neardarkroad1347

Жыл бұрын

@@greatninja2590 it is no masterpiece, that is for sure...but it is still a fun movie to watch

In 5:54 to 6:19 , It was still Johnny, screaming in pain. But in 6:20, it was already the Rider being glad and happy to be freed again in a new vessel.

@brennanhunt2722

24 күн бұрын

I wouldn't say he was in a "new vessel"; I'd just say the Spirit of Vengeance is back on earth. Anyone could become the Ghost Rider, it just depends on what possesses you!

@akiharashuguro2141

4 күн бұрын

​@@brennanhunt2722 i still don't get it

@jokerinthebronx

13 сағат бұрын

Cage improvised the laughing. He was really into the character.

The transformation scene is so accurate as to what might happen to someone in that amount of pain. While not as bad as it is to burn like he did from the inside out, I once experienced the same type of thing happen. I dislocated my left knee and instantly was on the ground. Pain was so bad that all I could do was laugh. Thought I was going crazy.

@livinglegend9709

Ай бұрын

Well one coukd say that zatharos( the angle of vengeance inside cage) is coming out. Since zatharos is pretty much insane, those laughs could be him being happy hes finally been released

@alexcorrales7322

Ай бұрын

Calm down edgelord

@Raigoth

Ай бұрын

@alexcorrales7322 I'm perfectly calm. Not sure how describing my own pain as well as giving an opinion on a movie makes me an "edgelord" wanna elaborate or are you just here to try and be a troll of some sort?

This movie was pretty raw for a 2000s movie, it still holds up pretty well and Peter Fonda did an incredible job as Mephistopheles.

@torquetheprisoner

Жыл бұрын

he was in easy rider

@jamessantiago2682

Жыл бұрын

More like Mephistopheles did an incredible job as Peter Fonda

@ashirvadin

Жыл бұрын

As did Ghost Rider as legendary Nicolas Cage.

@vladimirmarianoreis8353

Жыл бұрын

aLp

@chairthing

Жыл бұрын

Acting opposite a Coppola, you need to go all in

15 years later and this is still one of the coolest moments in marvel films. Just imagine this version of Ghost Rider in the MCU. Also Nicolas Cage always did have a way to just slay the crazy moments and that transformation really did show his abilities quite well

@Deinobi

Жыл бұрын

let's be honest here, whatever Disney can cook up right now could never be as cool as this

@Yodoggy9

Жыл бұрын

@@Deinobi I disagree; if Disney could work Cage into being an older Ghost Rider, like the cowboy one we get in this movie, it could easily surpass the cool factor! They’ve got the money for it, too!

@darkvoid3182

Жыл бұрын

@@Yodoggy9 disney only cares about money not the community

@dasunwilson8610

Жыл бұрын

kzread.info/dash/bejne/aX2qp8qFfqaafrg.html🥰

@Papa_Straight

Жыл бұрын

@@Yodoggy9 yeah they would cast a female ghost rider and make all the males look bad

Man I love how they didn’t use CGI for the transformation and instead just let Nicholas Cage use his own innate talent.

Cage's performance is so perfect, so sad it didn't hit. wish to see more cage play as role of superhero. he deserve more.

That laugh from Johnny is just amazing ...it's not him but the Rider inside him waiting to come out after a long time that's what makes him to laugh !!!!

@reixie

Жыл бұрын

u mean vengeance?

@superyoshiemonster3008

Жыл бұрын

Like johnny himself is screaming in mortifying pain while the rider is laughing, finally being out again after years of being hidden, it makes sense because at first Johnny is screaming in pain and doesnt know what's going on but when his skull is exposed and in flames he turns to sudden laughter, amazing writing and acting, amazing

@ryanroubert2483

Жыл бұрын

Not a rider inside Johnny. He was possessed by Nicholas Cage

@potatoechip2757

Жыл бұрын

Ahaha😂

@Mash3OH3

Жыл бұрын

It’s laughing at Johnnys futile attempt at trying to resist it lol

Damn I remember watching this movie everyday after elementary school now I’m 21 and this shit still go hard

@chasethemoney6129

Жыл бұрын

Facts makes me wanna ride

@Simmychann

Жыл бұрын

@@chasethemoney6129 fr fr

@jackthecommenter2768

Жыл бұрын

@@Simmychann fr fr fr

@KhaledMohamed-is5pl

Жыл бұрын

Yea I am 28

@AdrienRBLX

Жыл бұрын

Same bro btw I'm 18 now

16 years later, and this is STILL one of the most well put together sequences in any marvel movie

6:43 I can only hear "spongebob is faithful" and I might never be able to unhear that.

@lonelyboyandhistelephone5697

Ай бұрын

Damn you Now I can't unhear it

I really hope Nick's version of Ghost Rider exists somewhere out in the Multiverse for the MCU.

@Jmzhockey92

Жыл бұрын

no doubt

@Cerdo_asqueroso

Жыл бұрын

Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.

@Antwannnn

Жыл бұрын

He does. Everything goes. Even you 😉

@Luka2000_

Жыл бұрын

@@Cerdo_asqueroso no need to spam the comments

@iceberg6140

Жыл бұрын

@@Cerdo_asqueroso in all honesty I don’t think Johnny Depp would have suited the role of this character, nic performed perfectly he’s got that badass look to him and I think he pulled it off being the ghost rider I don’t think I can see Johnny being that sort of badass type. You have to admit we can’t unsee Nicolas as not being ghost rider. Despite how he got the role I 100% agree he nailed it for sure. Good on him👍🏻

Why did this movie receive so much hate? It looks Great

@Jairah0613

Жыл бұрын

Don't care about the haters care about the lovers

@user-vr8fs8gg6h

Жыл бұрын

It looks awfull dont lie

@ameybirulkar7503

Жыл бұрын

@@user-vr8fs8gg6h still much better than fat Thor and professor hulk

@user-vr8fs8gg6h

Жыл бұрын

@@ameybirulkar7503 that sucks aswell but so does this

@ameybirulkar7503

Жыл бұрын

@@user-vr8fs8gg6h no

The ghost rider's trasformation was like something beyond hell

9:42 changing the sound of the engine to something demonic works perfectly

His transformation scene still gives me goosebumps, the cgi still holds up!!

@deadpool3466

Жыл бұрын

for now...

@endeliggnist5066

Жыл бұрын

You're kidding, right?

@xManAvenger

Жыл бұрын

@@endeliggnist5066 I mean the transformation, like with his skin melting… not the ghost rider cgi.

@mamigyllenhaal2726

Жыл бұрын

​@@xManAvengerdon't you know? That particular scene was completely improvised by Nic Cage, no CGI or whatever, the man simply unleashed his inner Cage, seeing this, the director just kept on filming, and his decision clearly paid off.

@truongduynguyen3365

Жыл бұрын

​@@mamigyllenhaal2726 jqvfkdkkdkflfmkckfkfkfkkkkfkdikriirifirfkfxjjdjdjxjdkdkkddkkfrkfifkeiirfiieeiieifeifidiriddjrjkfrjfkrifkrifiririirjrirriirrjritkrkrrifkfjfiififijrrjrirfiriirririirifrjrirfirifirririirfirigirriitk😢❤😢😢😅😅😅😅😅😅😅😢😢😢😢😢😢😢😢😢😢😢😢😢🎉🎉🎉🎉😢😢😢😢😢😢😢😢😢kkdkfkrkiekdjdjdjiiddiififififjfifirfiririir😂y😢😮😮😮😮😮😮😢😮😮😢😢😢diiiidifiidififiifodorororroifjfrdidrjrifidifiifififdideirirrieisksiiswieieeieiddieiisieiieeeieieidieeeiieidieeiiieieieieeiiieeieeeieddieiririeieieieiieifoerere😂😂😊😅😊😊😊😊😊😊😊😊😊😊😊😊😊kdeiiddriridiriirrrrririrriirioroeoroerriiorrirrirririririeiirriirimhullggvkklfdjjkjjhhigdfgvjugzvcffffffbhggggffvgfgbgggnbhhjjhhhhhjjhhffgnkyhkjrdjyrfhhhgjjhhbggngfbhjnnjhtrnjhhhgbvvggjjgfffcdffffjifddhjjjddfmkm GvcdsssaZ😙😆😅🤣😀😍😭😁😅😆😅🥰🤩😊😍🥰😀😃😃😭😀🥰🥰😍🤩🤩😭🤣😆😘😂😊😅😘😆😁😁😀rhhhjbghnrbhnhghjhhhhhlheenhggffffgjyhrbregedhegretheefgerherbrgbrrtgggggffmmgdwqqwhkujjkkiookiiioigreseesghjjjjhfewqqjukjjjjyjjjtewqaaskouteyfhjiurrsdfhjiyyuffrrfjgyhggyygggttthrgbrgrghgrrrgfrrrrrrrffffffttrrreruiueueeueueeudeudeucrsnidjejjenjcejxjdjxeifrkicekidejiwiiedjsidjexidieijdcjdjejxjdsjxieidsidjjjjuwiejiedididiwiieiwidieisiudjdudidieisisidideiwixiweisieieoediidieekedkdkdoidididdiddjdjdi

This was by far the most malevolent character Peter Fonda ever played, but he pulled it off like no one else could. May an amazingly good actor rest in peace.

@richie9308

Жыл бұрын

He really carried the film I thought.

@debojitdowarah

8 ай бұрын

জন দদভথলযতথযমতথথণচ

Anyone else love the soundtrack in this film? Especially those dark guitar riffs like at 1:28. Christopher Young doesn't get enough credit for his work. He also did the music for Spider-Man 3 btw.

You can tell that transformation was PAINFUL asf. From the first *GAHH* like he was literally getting burned away from the inside. They/Nick Cage did a great job at showing the pain Johnny was experiencing. Ik that had to have been literal torture especially with Zarathos taking over

Great movie, just one thing annoying is that it doesn’t show the true power of the Ghost Rider. Literally one of the few Marvel characters to take out Thanos but for a 2000s movie this movie was great!

@ludvighstrup4266

Жыл бұрын

This is not great movie not 2000 movie is 2007 movie

@Dante-tb7gc

Жыл бұрын

Lmao it’s necessary to nerf OP characters buddy. Imagine if Lucifer(Netflix) was in accordance with his true powers per comics. There’d be no drama, no plot.

@SlapperTV

Жыл бұрын

@@ludvighstrup4266 I meant as in a 2000s movie

@SlapperTV

Жыл бұрын

@@Dante-tb7gc Why do they need to nerf him? If they brought the Ghost Rider back to the current MCU there’s quite a few opponents they can have challenge him and still have a great plot… Even tho Mephisto and his son were the main enemies in the comics and in these movies there are other powerful rivals of the Ghost Rider that they can make bad ass with the Cinematic Universe version 🤷‍♂️

@brucesbanner5057

Жыл бұрын

Good for a 2000 movie lol. Bruh this is 2007. you do know movies like Lord of the Rings and The Matrix were already out by now. This movie is garbage and looks like a group of kids made it for highschool drama class. The story, the cgi, the acting. All terrible.

That motorcycle transformation at 9:15 is way more wicked than I remember Ghost Rider rocks!

@evolve_exo2133

11 күн бұрын

I remember my dad showing me this movie in 2003 still a ghost rider fan today

that bike transformation never gets old

This movie was gorgeous, I still came back to watch this scene over and over. It bring certain level of satisfaction inside of me that I can't articulate in human sense.

Nicolas Cage perfectly portrayed the burning alive from the inside. No one, I repeat - NO ONE could do that.

@Json13th

Жыл бұрын

I can

@shadowfor1995

Жыл бұрын

I did it yesterday lol big deal

@thanqualthehighseer

Жыл бұрын

Have you never had a extra spicey Taco meal?

@ooofsized2036

Жыл бұрын

most people can lol

@FireTotodile

Жыл бұрын

diarrhea

One of the greatest acting performances I’ve ever witnessed. Thank you Nic Cage!

@Cerdo_asqueroso

Жыл бұрын

Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.

@aBhi-oz4hu

Жыл бұрын

@@Cerdo_asqueroso I like Johny but i don't think he will fit for this role. Nic did a great job

@personalclasslog6972

Жыл бұрын

@@Cerdo_asqueroso copy pasting the same shit in every thread?

@Cerdo_asqueroso

Жыл бұрын

@@personalclasslog6972 Oh I dont know what you are talking about. Maybe you are crazy, or maybe you saw a bot.

@randomfatman339

Жыл бұрын

@@Cerdo_asqueroso nah you said the exact same thing under a different comment

Most believable live action transformation ive ever seen. The water starts to first burn away from his eyes since they have the most exposed mositure. The pain from his body completely burning away, then the euphoria of knowing secrets of the universe while also holding massive anounts of power realizing you now feel the best youve ever felt, all while experiencing the most intense pain you have ever felt, realizing its almost over and going absolutly fucking BALLS TO THE WALL PSYCHO haha.

This movie is so underrated. I love it!!!

@akashsunshine7133

3 ай бұрын

No 1can beat this movie in theaters.. 💞🔥turbo

I love this scene, I especially love how he transforms the bike and starts riding it by saying "It's Ghosting Time!"

@Rodney_G2A

Жыл бұрын

Its Rider time

@tommyvercetti1111

Жыл бұрын

Ghost rider ghosted me 😤

@Aaleg

Жыл бұрын

It’s ridin’ time

@mr.knight8039

Жыл бұрын

Truly one of the scenes ever

@kevinduliesco5468

Жыл бұрын

My crush ghosted me

I don't care how bad or good this movie was. All i want is another Ghost Rider movie in MCU but powerful as he is in comics.

@deadinside7002

Жыл бұрын

@@SmartIndian_7337 is it good?

@ididntmeantoshootthatvietn5012

Жыл бұрын

​@@deadinside7002 lol when overproud indian people want you to watch that, of course its not good

@princemonzzzi2174

Жыл бұрын

@@deadinside7002 nope

@Tenchi707

Жыл бұрын

@@ididntmeantoshootthatvietn5012 😂

@unexplainedaf7469

Жыл бұрын

@@ididntmeantoshootthatvietn5012 What they say to every Indian man who becomes an actor: Welcome to Bollywood - would like a mustache or a beard?

Greatest scene ever in movies without doubt

Johnny: I'm not doing it Devil: you don't have any choice. So badass

I like this version better than the second one. Mainly because the way his skin wad burning of seems like it would translate somewhat well into actual reality.

@furionmax7824

Жыл бұрын

But the second is honestly good bc the fire is more realistic looking with the smoke coming off. And the fact that the bike, chain, and his clothes are bubbling like hot tar and charcoal black from the fire instead of this heavy metal looking skull look. It shows how the hellfire coming from Blaze is corrupting everything he's holding instead of just giving it a cool redesign. Zarathos was a corrupted angel of justice. Therefore his fire corrupts anything it touches.

@guyfawkesii7532

Жыл бұрын

I agree, but I wish they would have kept his Penance Stare the same as the first movie too, unless they did that to show he's an unstable Ghost rider lol

@Caliif

Жыл бұрын

@@furionmax7824 my biggest problem was that they didn't keep it consistent, I like the way he is portrayed in 2 but it's to big of a change looking at the first movie.

@furionmax7824

Жыл бұрын

@@Caliif well in the beginning it's implied he's been the rider for a while. He fled to a whole other continent bc he couldn't control zarathos anymore. But the change could've been done better. Like in the first one where his skin burns off. In this one it kind of just transitions I guess.

@Caliif

Жыл бұрын

@@furionmax7824 they should have shown how he loses control in a flash back or in the first movie, because here he can control it he just isn't used to it and in the second it's instantly "it's to dangerous, I can't let him out"

This movie is what made Ghost Rider my #1 favorite Marvel hero

Nic Cage was so perfect for this! We need him again.

It's interesting how both movies have their own ups and downs. If only we could get the third one that would combine the best of two worlds.

@kunalapte5816

Жыл бұрын

Could u elaborate on what things did both movies do best in their own way ? Edit: I'm not mocking tho, just genuinely asking for ur opinion.

@tc-channelhobby4051

Жыл бұрын

Two was shit to be honest, remake the second to fit the first narrative like the game did.

@xtrydelta7596

Жыл бұрын

needs more metal music

@juju_mitch

Жыл бұрын

The second one was God awful.

@dasunwilson8610

Жыл бұрын

kzread.info/dash/bejne/aX2qp8qFfqaafrg.html

I was 17 when I first watched this movie. The bike transformation scene was always badass to me.

@deadpool3466

Жыл бұрын

heh

@christianwilliam3687

Жыл бұрын

Hello 🤗

@jakobhardy1734

Жыл бұрын

@@deadpool3466don't you remember the time he penance stared you?

@deadpool3466

Жыл бұрын

@@jakobhardy1734 No. I could not see anything cuz my super suit was on me backwards on accident.

@deadpool3466

Жыл бұрын

@@jakobhardy1734 what does penance mean? it sounds dangerously close to sounding like penis. Im worried.

That’s one hell of an entrance.

I loved this movie. Way better then part 2. This was a classic, just like fantastic 4.

Ghost rider is one of the best and most underrated comic book character ever... Nic Cage was dope .. I've seen this movie in theatre and it's nuts..🔥

7:50 Now That's what we call a brilliance

This is is all about the design. Ghost rider looks metal as hell.

From childhood always my fav movie but those dialogues i undrstood now , its really humourous 😂 like hows my driving written on truck after hitting GR 😂 and many instances i still laugh like hell 🤣🤣🤣 he was the deadpool of that time i must say most badass 😂

"You're going down!" "I don't think so" 10/10 performance right there

@deadpool3466

Жыл бұрын

🥫🥫

This guy has all this power but can't do it himself? Johnny has a point.

@ashirvadin

Жыл бұрын

That's because it's not Mephistopheles's power. The Ghost Rider is Zarathos who is just under the control of Mephistopheles almost like a pet predator.

@tormentor2285

Жыл бұрын

mephistopheles was always quite limited almost everywhere, he follows strictly his code, and it works

@Klimbo93

Жыл бұрын

Say again, USA vs Russian every conflict last century?

@jeepamir508

Жыл бұрын

The thing is Mephistopheles limited on Earth with his powers. That's why he needs Rider

@Mash3OH3

Жыл бұрын

The Ghost rider is pretty much what the Silver Surfer is to Galaxtos A supernatural herald lol

Even after all these years, this movie is still just SO FREAKING COOL! Don't care how old I get Ghost rider will always make me smile!

This is definitely up there on my list of favorite transformations.

4:30 the cops was like" Okay I got it I won't be trying to catch him otherwise I'll make a fool out of myself"!😂

@Darthrevanthedarklord

Жыл бұрын

@@synophobia876 Tengen?

My favorite part of the whole movie is definitely this scene at 6:55. Wes Bentley's expressions are perfect with the Ghost Rider's punch lines :D

And Peter Fonda is marvelous in his acting as Mephistopheles!

Finally I funny KZreadr that goes straight into the clip thank you this is my favorite movie

A lot of people with myself included give Nic Cage credit for this scene and rightfully so. He's not so up his own ass that he's above going over the top and goofy for a transformation into an insane flaming demon.

@welovephilippineswithmylov5419

Жыл бұрын

😱

@sweetpsycho2022

Жыл бұрын

😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱

That CG was great knowing that they did this in 2007, I love this movie. Hope they have variant of Cage's Johnny Blaze in MCU.

i was blown away 10 years ago, and I am blown away now....

Aside from pirates of the Caribbean series this is my best movie as a kid and even now. I just love all of it I can’t even cap

7:02 me confronting my cat on the counter at 3 AM eating the bread bag

@edd4816

Жыл бұрын

Your cat: "We're not going to have a meaningful conversation now are we?"

4:26 i feel they missed a trick the speed gun should’ve recorded 666

@brianmason8400

Жыл бұрын

Hahahaha... nice one !

@Luis-tz8kt

Жыл бұрын

speed gun can’t track anything above 300 range

@darrenwallis7630

Жыл бұрын

@@Luis-tz8kt like this movie follows any like of logic or realism?

This movie and their *ODD* finger pointing thing is hilarious. Still love this movie foreverrrr

If you watch the whole sequence of him doing a 'pop-o-wheelie' @3:54 and watch it at 0.25x speed - you will see it was Tom Cruise who did the bike stunt for Nick Cage.

Ghost Rider & Nicholas Cage was perfect combination....no one can execute this role except Cage.

@1motorcitychop

9 ай бұрын

Keanu Reeves says hold my 🍺 😂😂😂 🍺

@VERGILGASM

8 ай бұрын

​@@1motorcitychopI don't think he'd accept

@jigzyonline

Ай бұрын

​@@1motorcitychopyes with his monotone ass voice. He couldn't do this.

6:23 normal tuesday for nicolas cage

6:33 that evil laugh while trasnforming is iconic

Couldn't put my finger on it, but I love how Mephisto, Blackheart, and The Hidden (Abigor, Gressil, and Wallow) talk in their normal voices, but you can hear the demonic background speech under their breath.

6:42 i like when he puting his head up while the music plays

Nick may be the greatest actor alive today. From performance to keeping his life in check and keep his private life private, a true gift for mankind.

@bananatiergod

Жыл бұрын

Dude spends thousands of dollars on the craziest shit left and right and ends up with insane debts he has to pay with his movies. Can't call that 'keeping his life in check' LMAO He is a pretty chill dude tho, and I love his mindset on acting. Definitely an interesting guy.

@j.calvert3361

Жыл бұрын

He did quite a lot of lame movies and some outright trash ....

@sarcasticguy4311

Жыл бұрын

Said nobody ever.

The bike transformation is the best..very nice Cgi..

9:33 cool 🔥

6:33 is me when i finally get the last kill on fortnite😂😂

7:16 ahhh yes. . . Air, Water, and truck driver

The ominous mysterious music before his transformation, love when movies do that

Still love this

I love the way the bike just threw him in the garage as if to say "we gotta do something about that skin John".

This movie is so freaking awesome. GREAT ACTORE JUST ABSOLUTELY AMAZING

“Please, have mercy” Bro you just hit me with a semi

Nicolas Cage at his best.❤‍🔥

This is definitely my most favorite movie with the marvelous Actor - Nicolas Cage!

Man I wish that we got an r rated ghost rider movie. This was a good movie but it sadly went unnoticed

@Masked_SVincent

Жыл бұрын

I think the writing and storyline could’ve been done better, but I def don’t thinks it’s as bad as people make it to be

@jackratscratpack9323

Жыл бұрын

Doesn’t need to be r rated don’t need blood with ghost rider he leaves nothing but ash and brimstone and charred skeletons

Thanos (to Thor): You should've gone for the head Ghost Rider (puts hand on Thanos shoulder): Hey...Dirtbag....

Still gives me goosebumps

You wont believe the happiness I got from watching this

That scene where horse ghost rider & cage go for a ride always gave me goosebumps as a teenager..Movie was great for the 2000s ..But also I felt like it went downhill after the first movie

@cristianpreiti119

Жыл бұрын

I VERY MUCH AGREE WITH YOU,MULAMU....

That whistle at 09:07 😵

@janethmuganyizi3155

7 ай бұрын

Cartoons...

I remember seeing this transformation scene for the first time on the big screen. I went NUTS over this. I thought that it was one of the most EPIC scenes EVER!!!!! I was like "HOLY SHIT!!!!!!!!!"

Jason Momoa and everyone involved in making Fast X: Have Mercy. Me: (8:29) Sorry, All Out Of Mercy!

Love how the bike has its own personality and mind of it's own.

i love nicolas cage as johnny great acting you can see how johnny is getting high in the power until he looks at his hands and he realizes hes burning, power and fear fight and fear dies sheeesh i hope we see him again

Not to mention that bike metamorphosis was killer. To bad they changed the bike in the second one 😂😂😂😂

I love this movie. Its awesome.

8:57 and that kids, is where gravel comes from

Damn i want cage back as the hellrider like toby & andrew

@kunalapte5816

Жыл бұрын

Yeah, probably something like a mentor/guide for Robbie as he had Carter Slade for him and maybe even have him transform into the blue rider we saw at the end of SoV.

@abhishekbarua360

Жыл бұрын

@@kunalapte5816 agreed brother🙌

@Cerdo_asqueroso

Жыл бұрын

Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.

@alecrocksablegaming

Жыл бұрын

@@Cerdo_asqueroso looks like someone doesn’t have taste and is butthurt what’s wrong dad didn’t give you any attention when your younger?

@garvitchauhan6265

Жыл бұрын

@@Cerdo_asqueroso Just because he was a big fan of Ghost Rider and who doesn't want to be a superhero? I always thought that Nic Cage was good but the writing and direction of the movies were bad.

Underrated movie 💯

7:50 the camera work, the heavy footsteps, the "whatever" edgelord expression, the cheesy one liner, the green/blue color scheme. This all screams early 2000's and I love it lmao

@Luka2000_

Жыл бұрын

This literally came out in 2007 wtf are you talking about

@gustavopereira4924

Жыл бұрын

@@Luka2000_ 2000's means movies from 2000 to 2009 fucker

@audax117

Жыл бұрын

@@Luka2000_ Exactly? 2007 is still early 2000's

@houstonhelicoptertours1006

Жыл бұрын

@@audax117 No. Stop huffing glue.

@Luka2000_

Жыл бұрын

@@audax117 literally toilet brain

Demon: have mercy Rider : ooh at of mercy. That line.. Madddd

@minatothefaster1788

Жыл бұрын

Sorry All outta mercy 😄

Everything about ghost rider is amazing

awsome ghost rider absolutly awsome

@8:46 his human scream muffled by the demon scream is terrifyingly good! Gives you a sense of how powerful the rider is. Granted I don't know much about the history of Ghost Rider. So I don't know how powerful he really is.

@losever1177

Жыл бұрын

He is strong that he beat doctor strange by just staring at him and fight the avengers by himself alone and beat galactus by staring at him.

@AgroFro

Жыл бұрын

He's pretty op

@amarson2322

Жыл бұрын

ghost rider could solo the entire avengers pretty ez, thats how powerful he is. If he joined MCU there would be no need for Endgame cause he would kill thanos by staring at him3

@Emirthemarvelfanboi

3 ай бұрын

​@@losever1177 really? Do you know the comics name? I want to read it, because it sounds very cool 😂