I am Brazilian and Greetings For Afeghanistan People ! 👏👏👏👏👏

@RashidaHussain

13 күн бұрын

Wow from Brazil! I'm glad to hear that. Thank you for your valuable comment 👍

I wish him the best in life. He has a good work ethic.

@RashidaHussain

9 ай бұрын

Yes! He is doing very well at this. May God grant him more success. Thanks for the comment 👍

@-Pawuloniasty-

8 ай бұрын

Ethic? Maybe. Hygiene is worse...

@SpeedFreak999

15 күн бұрын

Who gives a shit he's just a 15 year old boy ​@@-Pawuloniasty-

@Pneuma6969

Күн бұрын

sorry but how delusioned are you? you know where he lives? like, what circumstances they have, and what possabilitys? like, its not europe, america or russia or whatever, its afghanistan and from what ive seen here is still 1000x better than in india. o​@@-Pawuloniasty-

Respect for all hardworking boys in Afghanistan.

@RashidaHussain

4 ай бұрын

Indeed! May Allah give him more success.

@harukatakahashi8822

2 ай бұрын

How about Mexico?

@z6aq708

Ай бұрын

@@harukatakahashi8822fuck Mexico

@user-nw8jx6mh6d

26 күн бұрын

This isn't Afghanistan I think it's Pakistan the language is Urdu the car look familiar just so you know I live in Pakistan

This kid is more grown than most grown folks nowadays 😒

Salute to this child😢

@RashidaHussain

9 ай бұрын

Yes! He is doing very well at this age.

That is what I call a hard working young man I give him all the respect keep going bro make your family proud

@brentschmogbert

13 күн бұрын

It’s a child and he should be in school

@Highskill3r

10 күн бұрын

thats not a young man that is a child my friend.. why is he not in a school?

Such a hygienic potato cutting area

This Kid has got skills and talent, Insha-Allah when the boy grows up he Runs a successful Restaurant Business !! 😇👏🏽

@RashidaHussain

4 ай бұрын

Indeed! I hope so. May Allah grant him success. Thank you for your valuable comment 👍

@TheJono1170

3 ай бұрын

Haven’t got the skills of hygiene

@dreamzeroyt2180

3 ай бұрын

@@TheJono1170 You can only comment but you Haven't got the skill of helping people

@TheJono1170

3 ай бұрын

@@dreamzeroyt2180 how am I supposed the help this prick

@slaveoth5114

2 ай бұрын

Why saying Insha-Allah to an indian kid?

He looks younger than 15... still, more power to him😊❤🎉❤ Blessings be😊

@RashidaHussain

9 ай бұрын

Yeah right! May God grant him more success. Thank you for the comment 👍

@LatishaHenderson-cy1vq

8 ай бұрын

etuivfdsdhjxnmmjvxsrteyiiiopufzsxmm🎉❤😢😢😢😮😮😅😅😊z fsdfvgb ..dgtrwesbhnhdszsfgghbn mxssddgtretyyuujolhssdffghhffffgv mmweewddgfhczxvbnmm🎉🎉🎉❤😢😢😮😮😅wrrrraaaaddffhghreeyynmkksaassdxxzzvvbbnn.mnsdghhjytewqqqwqassdfggfvxxvnnnvdazjnzxcvbbm🎉🎉❤😂🎉🎉🎉😢😢😮😮😮😅😅😊saddddddzghcxhhasxxcvvbddadrrrtyyyeeryuioadkjgfnn to wwqqssdasxxxdfggvbbxzmrhuujogfsghhjxc 2:29 vbnmrrretyaassdasqwwsddfgvzxcbn🎉🎉😢😢😮😮😅❤❤❤😂😂

@LatishaHenderson-cy1vq

8 ай бұрын

xfgffv🎉🎉😢😢😮😮

The container he is putting he fries in needs,a good scrubbing and never heard of putting flour on fries before. This young man knows what he's doing , hope he earns enough to help him and his family.

@RashidaHussain

7 ай бұрын

Yes! He half-fries some fries, so when it's rush hour, he fries them whole, so that saves him time and the customers. He adds corn flour to make the fries crispy. May Allah give him more success. Thanks for the comment 👍

@comicaiadventures

Ай бұрын

WELL YOURE IGNORANT LOL

@mahmoudsharif3864

Ай бұрын

He adds corn flour to make it addictive and tasty so customers can come back all the time

@tombruna4650

18 күн бұрын

Corn starch

@mosaici.t.s8766

17 күн бұрын

Maybe not flour, but chipwhite.

Such a hardworking boy.

@RashidaHussain

8 ай бұрын

Yes! He is doing very well at this age.

Nice video. That’s really fun. Great cooking. Thank you for your sharing. Have a great day my friend

@RashidaHussain

9 ай бұрын

I'm glad you liked the video! Yes, he is doing very well at this age. Thank you for your valuable comment 👍

美味しそうですね〜😋💕頑張って！

Definition of a true hustler 🔥🔥🔥💪🏻💪🏻💪🏻

Very healthy environment for food making. 👍

@drinkmorewater8791

28 күн бұрын

LOL 😂

Yummy! I love french fries! 🥲👍💯

Awesome talent ❤❤ done fullwatch your video. New friend here

went from 8 to 15 in 2 years .. amazing

@deagle2yadome696

14 күн бұрын

what do you mean

محنت میں عظمت

He is a skilled child. God Bless him. 🙏🙏🙏

The way he works is so efficient and got steady hands for such work and such his age

@RashidaHussain

4 ай бұрын

Yeah right! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍

Strong hard working boy I hope he makes millions

@RashidaHussain

9 ай бұрын

Hope so! Thank you for the comment 👍

@DjWellDressedMan

9 ай бұрын

Economic Child Exploitation, a Child should be in School learning

@Smilemery

2 ай бұрын

@@DjWellDressedMan Lamentablemente no todos los niños tienen esa oportunidad

@harukatakahashi8822

2 ай бұрын

​@@Smilemery like mexican kids

So proud of these hardworking dedicated people. God bless.

flies included!

Fries and flys

ماشاء الله تبارك الرحمن.. سيكبر رجلا حقيقيا أسأل الله تعالى أن يوسع رزقه🇵🇸💚

@DreadWing7777

9 ай бұрын

🙏A.M.E.N🙏

mmmm Flies with some Fry's! Double protein yummmy.. Keep up the work..

wow!!fantastic job ,hard working young man

Картошечка в условиях антисанитарии да на пальмовом масле, мм вкусно а!

@Zadumych

Ай бұрын

Зато сколько приправы летает мясной =)

0:12 His fast cut potato fries 🤔

My favourite food "Potato fries!"

God Bless this kid 🙏🥰❤️

QUE BUENO, LAS MOSCAS SON GRATIS

Assalam u Alaikum bhai mai hamesha apki video sath jo add ate hey wo bhi dekhti hu Allah pak apko kamiyab karey Ameen

Good job kid . U selling food and always keep ur work station clean i love that !

Wish all the best for him. He was literally better than me when i was the same his age. 👏🏻

🍔🤔🍟🍕😊🌮🍚🤗🥢🥱👛 8:50 I love it when y'all eating tha food! It makes me want to go travel there just to taste it yummy. Thanks you guys looks great keep up tha great work you guys.

@RashidaHussain

9 ай бұрын

Wow! I'm glad you liked it. Very welcome and must try it. Thank you for watching and valuable comment 😇👍

@axjacobsen295

3 ай бұрын

Enjoy your food poisoning

Bom dia,tiro o chapéu pra o menino, como ele é muito trabalhador e inteligente, ele faz serviço de adulto 😮

That looks much better than every fast food fries

This makes me value my job wish this kid the best

He has excellent work ethic he's an authentic young man.

سبحان الله وبحمده سبحان الله العظيم

Seeing how food in china is made im glad this people earn their pay with honest work

Amazing Kid❤ .. Later will be success..❤

@RashidaHussain

9 ай бұрын

Yes! He is doing very well at this age. InshaAllah! May God grant him more success.

He is a beautiful boy and champion😊

@RashidaHussain

8 ай бұрын

Yes! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍

@cristianetorchesenkavabata

8 ай бұрын

🥰

Mashaallah❤

Hardworking and inspiring for others 😍

@tedbell4416

9 ай бұрын

God bless the White man

Hope one day you will become a millionaire ❤

@queenelcene638

9 ай бұрын

Billionaire, 😮😮😮lol😊❤🎉❤

wow they look lovely

The way he working hard and motivated to his job I hope a good life for him I’m sure that will come fatser

Ese niño trabajando desde tan joven, será un hombre adulto de bien 😊👏

@RashidaHussain

9 ай бұрын

¡Sí! Le va muy bien a esta edad. Que Dios le conceda más éxitos. Gracias por mirar, estad atentos para más vídeos callejeros.

@user-ge2hu4kf1w

9 ай бұрын

@@RashidaHussain ииииииииииииииии

@thegeneralscience6040

8 ай бұрын

​@@RashidaHussain sir I'm from India I want that potato cutting machine and we can make

Allah pak hamarey pakistan ke halat achey kar dey Ameen

@kanaomar3375

9 ай бұрын

Our prayers are with you guys,insha Allah love from Kenya

@ChatoriAsiya

8 ай бұрын

Thank you so much

Kid works harder then most Americans i know. Myself included.

I need one of these presses mounted in my kitchen lol

very hardworking kid with crunchy and tasty fries keep up the good work son

@tedbell4416

9 ай бұрын

Thanks dad

Much love from Brazil

Lovely ❤

And our children are so lazy to wake up in the morning to go to school.. ☹️.. those childs like him are real human with strength. Big respect

Einfach Klasse, dieser junge Mann hat eine große Zukunft vor sich. 👍❤️

@BadDecisions32

5 ай бұрын

great future yeah sure mate..😅

@axjacobsen295

3 ай бұрын

Frittenkoch... Herr Heise, zu mehr haben Sie es scheinbar auch nicht gebracht.

@thomasheise5112

2 ай бұрын

​@@axjacobsen295keine ahnung wo ihr problem liegt aber ich habe keines. :) Überall auf der Welt werden Pommes verkauft, ist das jetzt was schlimmes?

@TWay-yf5zm

2 ай бұрын

Great future, ahahah

بسم الله ماشاء الله...دول اللى يعتمد عليهم

The fries do look delicious 😋

اللهم بارك للفتى ووسع له ابواب رزقك يا ارحم الراحمين تحياتي للباكستان 🇸🇦

@Pashtun.Taraki

Ай бұрын

و الله يقوي المسلمين. لتحرير الأماكن المقدسة للمنافقين الإسلام

o garoto trabalha honestamente desejo prosperidade para ele parabéns

@RashidaHussain

9 ай бұрын

Oh sim! Ele está indo muito bem nessa idade. Que Deus lhe dê mais sucesso. Obrigado pelo comentário.

Nice sharing Vidio..very inspiring and creatif.. good luck.. masyallah 🇮🇩🌺🌼👍👍

Keep Up The Good Work Brother 👍🏽

Hardworking is better than school 👺👍

Too many flies Someone buy the kid some fly zappers

Full of respect for this young man... hard work and pasion make him rich some day, i hope for that ;)

@RashidaHussain

9 ай бұрын

I hope so! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍

@mieszkowisniewski835

9 ай бұрын

@@RashidaHussain welcome... Always I am full of respect for peoples who doing something good in their lives. In my opinion this boy is also a motivation for someone... Many thanks for this video

الله يرزقهم وغنيهم يارب العالمين اللهم امين

He's grown up❤

I pray whoever eyes catch this God give you the strength you need to overcome every battle your facing may the dark thoughts and overthinking,my be peace and calmness fill in your life🇧🇸❤️

I will eat that..looks yummy..🤩

GOOD WORK KEEP IT UP ❤

Work will set you free ❤

What is the white powder in the beginning?

@RashidaHussain

9 ай бұрын

This is corn flour.

Delícia batatas fritas, parabéns para o garotinho ele é muito habilidoso.🍟🍟🍟🍟😋👏👏👏🤗🇧🇷

@RashidaHussain

9 ай бұрын

Sim! Ele está muito bem nessa idade e deixa as batatas fritas saborosas. Obrigado pelo seu valioso comentário. Fique ligado para mais vídeos de rua.

@alexmonteiro4267

9 ай бұрын

Nunca vi tanta mosca....dá medo viu.

@marcosgorreri8532

9 ай бұрын

E porco tambem

@JohnnP7

7 ай бұрын

​@@alexmonteiro4267infelizmente lá é assim..

@marlonoliveira7785

6 ай бұрын

Vai comer, de lá vc não volta kkkkk

Cool kid making some yummy fries

8:10 i thought the fly was another ingredient 😅

Антисанитария писец какая!!! Картоху с мухами я бы не стал пробовать

French fries along with french flies 😂

@uqiesyukri7282

9 ай бұрын

Haters alert

@tommyhassan3545

9 ай бұрын

Jealous mug

@Varenozz

4 ай бұрын

useless kid in the family, u only can ask money to ur parent, candy boys 😂

@CALILIFE8251

Ай бұрын

Come on guys he’s just adding some humor 😂

@14k46

Ай бұрын

@@CALILIFE8251 lol

This Guy is amazing

FRENCH FLIES

@RashidaHussain

Ай бұрын

Yes! He makes it tasty with flavour spices.

The 10 year old kid has worked him self to the bone, working 25 houres a day the last 15 years. Amazing.

If he’s 15 than I was born on Mars

@miragebangbravern2024

9 ай бұрын

In my school back when I was 15, everyone looked younger for their ages for the most part. It's not like in western countries where a 15 year old can look like someone in their early 20's.

This young chef boy is fascinating with his French Fries cooking, more later about his hardwork can relate on his own best. Love from Philippines

@NazriB

8 ай бұрын

Lies again? Driver Chauffeur USD SGD

Mashallah Allha Protect You Brother

Cool videos my best friend ❤❤

es la cocina más limpia que veo de todos, el niño es muy sistemático y dedicado a lo que hace.

@RashidaHussain

9 ай бұрын

¡Sí claro! Le va muy bien a esta edad. Que Dios le conceda más éxitos. Gracias por mirar, estad atentos para más vídeos callejeros.

@z-iroc9932

9 ай бұрын

Está llena de moscas seas mamon

Welldone he already know how to survive at young age

@RashidaHussain

9 ай бұрын

Yeah right! May God grant him more success. Thanks for the comment 👍

He faster than furious 😂

Still better than at Burger King, well done. Love the Indians being frugal with their ingredients.

@tedbell4416

9 ай бұрын

Nah burger king is better

He has to be in the school. Not at work

@aymn-art546

9 ай бұрын

This is all because of the corrupt countries that waged war in their countries, such as America, France and Russia. They are the cause of chaos everywhere

@uqiesyukri7282

9 ай бұрын

Haters

@SDtraining627

9 ай бұрын

School makes you poor.

@kakibesi7760

9 ай бұрын

today is holiday...maybe part time job..take it easy,dude

@dktdc

9 ай бұрын

Since you’re so concerned about his education, maybe you should put up the money to make sure that he gets proper education. Otherwise, he doesn’t need career advice from somebody farting behind the keyboard.

Beautiful Kid Send Me Some My Favorite Love California 💚❤️

اللهم صلى على سيدنا محمد وعلى اله وصحبه وسلم ❤❤❤❤

The bugs buzzing around make it look much more appetizing!

Syf i bród nigdy bym tam nic nie zjadl😮

@azunitedstates5615

8 ай бұрын

Exactly 😂

@RashidaHussain

8 ай бұрын

Nikt nie prosi cię o jedzenie. Frytki są czyste i pyszne. Muszą tylko posprzątać to miejsce.

@RashidaHussain

8 ай бұрын

@azunitedstates5615 No one is asking you to eat.

If the flies land in, extra protein

Good job 👍😀

Do the flies and black cooking oil cost extra?

@user-ue2si8ym7y

8 ай бұрын

There is black oil in your local restaurant too loll go check behind the scene videos on youtube 😅

@TWay-yf5zm

2 ай бұрын

​@@user-ue2si8ym7ystop defending that boy

hygiene -50%

@WyattRyeSway

Ай бұрын

That high?! Ummm…..

@aryaa00anm

Ай бұрын

Shut up. And i beleive you are white

@ALI-zk7tg

Ай бұрын

-10000⁰10000000000000000000

@fungsia5549

20 күн бұрын

its the streets. what do you expect.

13 күн бұрын

Wie du siehst mein lieber es ist unhygienisch! Aber das muss man auch akzeptieren dass das die Leute noch alle lebendig sind und es jeden Tag so weitergeht.