Пікірлер

• 
  @switchyCnr9113 күн бұрын

  “Should we mute, or should he yap chat?”

• 
  @MX_JVD11 күн бұрын

  Bro this is eom crazy editing skill man!

• 
  @AbrahamPartida-sn1lg12 күн бұрын

  BEST SONG I'VE EVER HEARD🔥🔥🔥

• 
  @DumbForte17 күн бұрын

  woah

• 
  @assanimations-nr6wm17 күн бұрын

  The soundtrack is called Big Mac when it's playing a remix of Burger King music

• 
  @CurlyWenja17 күн бұрын

  First

• 
  @Meme_maker62417 күн бұрын

  Caseoh's theming athem:

• 
  @I_forgor_skull22 күн бұрын

  THIS AIN’T FIRE, THIS IS FLAME GRILLED 🔥🔥🔥🥶🥶🥶🍔🍔🍔

• 
  @MeiseryThePizzaTowerFan22 күн бұрын

  1:16 pizza tower lap 2 reference?

• 
  @YouTubeofficialsite10 сағат бұрын

  Uhm is a remix schoolhouse trouble and big Mac trouble

• 
  @YRUSJR224 күн бұрын

  unironically goes hard

• 
  @juanatorres904024 күн бұрын

  Do we need headphones?

• 
  @Wee_Mewon26 күн бұрын

  WHOEVER MADE THIS COOKED! and caseoh ate

• 
  @remen1015games27 күн бұрын

  스킨이 예쁘네요❤

• 
  @pan.matvey_and_more_videos27 күн бұрын

  0:44

• 
  @pan.matvey_and_more_videos27 күн бұрын

  Finally after 3 months, I found it!!!

• 
  @hmtheresaconlanger29 күн бұрын

  You're* But nonetheless cool edit

• 
  @NoahTV542929 күн бұрын

  0:00 - 0:44 looks like a meme because its in 360p as the max quality

• 
  @juanatorres9040Ай бұрын

  Uh oh

• 
  @NoahTV5429Ай бұрын

  omg you converted it to mp3 the way i did :O

• 
  @MikeAfton280ScratchАй бұрын

  Well, nice soundtrack. I wonder if the guy who named the soundtrack even listened to the music.

• 
  @CurlyWenjaАй бұрын

  God dayum bro this kids crazy.

• 
  @arthurhoffomann123Ай бұрын

  😮😂

• 
  @SilverYoru-hf5xeАй бұрын

  YO THIS SHI IS 💥💥🕺🏻🕺🏻🕺🏻🍔🍔🍔🍔

• 
  @MX_JVDАй бұрын

  You should’ve add like, the screen glitching a bit, but still good work buddy

• 
  @NovaGamesLOLАй бұрын

  I did the like glitching stuff was me.

• 
  @MX_JVDАй бұрын

  @@NovaGamesLOLoh my bad, I like your videos

• 
  @anitamunozgarcia2084Ай бұрын

  bkfaftfrttttttttyrqareeeeeeyrserwwaasreaewa23ááaaaaaaaaaaaaaaaaaaereeeeeeddeddddddddeees😂wawafgfdsaaaaaskyeysaeeeaawaaawasgdfdfffway..my..way

• 
  @anitamunozgarcia2084Ай бұрын

  wy..way

• 
  @Dustfell.HotlandАй бұрын

  GF:"If you and Silly Billy were to do a Rap Battle, who would win?" BF:"Well if Silly Billy was to use his Domain Expansion: Silliest Billy, it might cause me a little trouble.. GF:"But would you lose?" BF:"Nah, I'd rap." BF:"Are you Billy because you're silly or are you silly because you're Billy?" Silly Billy:"Throughout the Sillys and the Billys, I alone am the Silly Billy. Domain Expansion: Silliest Billy. Silly Technique: MY WAYYYYY!!!!"🗣️🗣️🗣️🌌🌌🌌🌌 BF: 💥

• 
  @RyuraiSnowАй бұрын

  I got goosebumps when I saw this😅

• 
  @Ana_3322Ай бұрын

  aaaaaa fofo

• 
  @userthing640Ай бұрын

  ill maaaake you sayyyyyyy how proudddd you are of me so stayyyyyyyy aawaaaakeee just looooooong enough to see....MY WAYYYYYYYYYY...........my wayyyyyyyyyyyy..............

• 
  @White_beard707Ай бұрын

  Me when i got q good report card:

• 
  @user-xw7kr3ho7lАй бұрын

  MY WAY

• 
  @sidboypampuАй бұрын

  Schoolhouse Trouble? No. Crackhouse Trouble? No. Whopping Trouble? Yes.

• 
  @ChocolateSyrupOSCАй бұрын

  Pov: caseoh is chasing you and gonna eat you

• 
  @baldimore340Ай бұрын

  ┗|｀O′|┛it's so good

• 
  @CaseOhsBasicsDevАй бұрын

  i have monkeys in basement

• 
  @AFish2147Ай бұрын

  I would love if Caseoh ate parts of the map as time goes on

• 
  @thatonefrankieАй бұрын

  you would be able to escape easier, or is case blocking the way?

• 
  @AFish2147Ай бұрын

  @@thatonefrankie Like ishann blocking parts of the map but instead eating it but nothing so it makes it impossible

• 
  @Wyatt862Ай бұрын

  caseoh should've became a 1x1 lego brick and started throwing lego bricks at you slowing you down making a lego brick breaking sound lol

• 
  @othamnebenider2520Ай бұрын

  This should be a friday night funkin mod

• 
  @coward7824Ай бұрын

  Blocked

• 
  @valmine7507Ай бұрын

  big trouble at mac

• 
  @MX_JVDАй бұрын

  Do you make these?! If so what do you use? This is awesome!

• 
  @NovaGamesLOLАй бұрын

  I just go to the game, and find the battle which takes me 6 - 8 hours because I have to get a new save to do this I think, so yeah.

• 
  @CommanderXRRАй бұрын

  New subscriber!

• 
  @TheMagicDragon-mm5drАй бұрын

  Raldi's Crackhouse ahhhh beat 🗣🗣🗣🗣🗣🔥🔥🔥🔥🔥🔥

• 
  @MainIsHerelolАй бұрын

  one guy in the raldi's crackhouse team made this game so thats why (talking about ronezkj041 or smth)

• 
  @TheMagicDragon-mm5drАй бұрын

  ronezkj041 boutta get banned ahhhh beat 🗣🗣🗣🗣🗣🔥🔥🔥🔥🔥

• 
  @KaotikCokeАй бұрын

  this song is amazing! inside my mind: sans last breath phase 2

• 
  @nightmarecatzzАй бұрын

  your good take a sub been watching some of your shorts

• 
  @NovaGamesLOLАй бұрын

  Sorry for the lag in the middle, for some reason it did that.

• 
  @RedGeometryCat45Ай бұрын

  Where did you get that caseoh sprite

• 
  @AFish2147Ай бұрын

  The game?

• 
  @EvilpronggАй бұрын

  Yes​@@AFish2147

• 
  @TadtheSwagАй бұрын

  Who knew that throwing salads at a quarter pounder would be the most hype thing known to man?

• 
  @Gumbo354Ай бұрын

  WHY IS THIS SO FIRE 🔥????

• 
  @someoneidk3212Ай бұрын

  🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗 Edit: I’m getting banned 💀