Hello everyone,
Welcome to my channel.
Ajke chole elam newly launched the FORMULARX HYDRASHIELD VITAMIN C + PEPTIDE WATERY GEL SUNSCREEN er review and demo niye.
Asha Kori tomader valo legeche.
Jodi kono question thake please janio comment section e.
R video ta valo lagle please like share and comment koredio r please subscribe koredio jara koroni.
.
.
.
.
.
.
#formularx #formularxsunscreen #honestreview #bengali #sunscreenunder800
#theformularxhydrashieldvitamincpeptidewaterygelsunscreen #sunscreen #sunscreenforsensitiveskin
Music Credits:
Music: Long Distance Relationship
Musician: CMT8
URL: pixabay.com/music/long-distan...