Avicii Alan Kygo All time favourites💯❣️☺️

@alannawalker8601

3 жыл бұрын

Alan Walker is my most favourite music artist 🥰🥰🥰

@realisticgaming9094

3 жыл бұрын

reverse the sequence.

@donttakemeseriously.8402

3 жыл бұрын

same

@a-nhn1702

3 жыл бұрын

and the chainsmoker he's good too

@manojverma5136

3 жыл бұрын

@@RobynFrost yes man mine too

:D

@Staywith7q7

6 жыл бұрын

K-391 !!!!!

@Sleeper_oK

6 жыл бұрын

k-391 😱😍😍😍😍😍 i love you 💖

@guillaumeblain4726

6 жыл бұрын

2 legends

@geancarlomite8759

6 жыл бұрын

I love your music :3

@PROMIXMusic

6 жыл бұрын

Hi

Ohhhhmmaaan it nostalgicc:")

@ZapDon777Music

3 жыл бұрын

Heart from Alan Walker, yet no likes. This proofs that Alan reads all comments :)

@lafandars3580

3 жыл бұрын

@@ZapDon777Music yea

@talalnaeem2563

3 жыл бұрын

@@ZapDon777Music im so happy

@enigmas_karnivore28

3 жыл бұрын

Muahahaha

@makotoGhostsenshi

3 жыл бұрын

ʜɪ ᴘᴀᴛʀɪᴄᴋ...ᴄᴏɴɢʀᴀᴛs ᴄᴜᴢ ʀᴇᴄᴇɪᴠᴇᴅ ʟɪᴋᴇ ғʀᴏᴍ ᴀʟᴀɴ ᴡᴀʟᴋᴇʀ....ɪ ʜᴏᴘᴇ sᴘᴏɴɢᴇʙᴏʙ ʙᴇ ᴊᴜsᴛ ғɪɴᴇ😂

December 2020 Original song: 37 million Alan Walker remix: 43 million

@NagaVillageLife231

3 жыл бұрын

BECOZ ALAN WALKER IS BEST

@bobraekevelt7953

3 жыл бұрын

Ok but too be honest he made this song lit

@manujafernando5921

3 жыл бұрын

A fan of alan walker forever

@manujafernando5921

3 жыл бұрын

@@Harry119music I said because I want to, you just don't talk nonsense

@bluekygo6915

3 жыл бұрын

But the original deserves more views😪

I miss this old Alan walker style music

@THEFIRSTBROOFTHETHREE

6 күн бұрын

Same here

Fun fact: you're not here for the first time

@TheoryYT

3 жыл бұрын

😜

@doctabyte5370

3 жыл бұрын

Nor is this your 10th time

@shreyanaik3956

3 жыл бұрын

@@doctabyte5370 yep...true dude

@storm_omega4169

3 жыл бұрын

😄😄

@ashervl7495

3 жыл бұрын

This song gives me nostalgia :>

Hey person scrolling through the comments right now, you'll probably never see me ever again because I'm only 1 of the billions people out there, but all I wanted to say was, I hope you have a wonderful day. Don't let anyone or anything bring you down. You're special in your own way and don't let anyone or anything take the feeling of being special away from you. Love 💕💕💕💕❤❤

@pearlgirl7826

Ай бұрын

Thank you. You might see yourself as only one of billions but you are ONE of billions. You are unique and special. 👍

2024 Anyone?👇👇

@magicalviews3245

16 күн бұрын

Me

*perfection in one song*

@jacobmartinez7559

6 жыл бұрын

Cami Currao good song

@jacobmartinez7559

6 жыл бұрын

Good song dude

who is here before 1M views?

@urfavworstnightmare5631

6 жыл бұрын

meeeee :D

@AhmedMohamed-zk7ou

6 жыл бұрын

VoHaYo

@kelley3470

6 жыл бұрын

Me

@beatec252

6 жыл бұрын

@Kelley Playz How can that be. For me it now shows 1,054,161 views 20 minutes ago.

@spectrablade7473

6 жыл бұрын

Nuuuu, i was at 1.1 mil... feels bad

My longest, most beautiful and purest relationship ended yesterday. This song keeps me moving and hurts at the same time, huh...

@DarkzzMusicOfficial

2 жыл бұрын

Life just hurts doesn't it? Well I dont think there's nothing we can do to avoid them can we? If you ask me, I'd say I use music to get over them. Take this song for example. The lyric "Someday we'll get there" resembles how we can get through our hardships and we can make it out of it. I'm not sure if that is what it actually meant, but I see it in that point of view. These things are just a parcel of life and it's on you how you want to take it. Anyways, wishing you best of luck in your life

@realaedryn

2 жыл бұрын

@@DarkzzMusicOfficial Thank you so much. Life surely hurts now, but I definitely learnt some things. Even though it's still hard to breathe and not to cry, I will try my best to keep moving. Thank you 😌

@realaedryn

2 жыл бұрын

@Disha thank you!

Who is still listening to this masterpiece in 2023?

@hlpatwa

3 ай бұрын

Me

*this song gave me memories of things that didn't happen*

@samaviation6399

4 жыл бұрын

IKR IT'S LIKE BEING WITH SOMEONE SPEICAL ON A HIKE UNDER THE STARS

@dakshs9528

4 жыл бұрын

It makes me feel like I'm in some national park forest in Canada under clear skies surrounded by grass and mountains

@earthling03

3 жыл бұрын

Yeah it does that to me too.

@thunder_girl

3 жыл бұрын

Woaahh it does that to me too!

@randomguyontheinternet9107

3 жыл бұрын

@Kenya fang bro same. I thought I was the only one who thinks of memories that have never happened or existed.

Sounds amazing

@ClassicMilk59

6 жыл бұрын

DJ AG 私はこの歌が大好きです

@ClassicMilk59

6 жыл бұрын

DJ AG I speak Japanese and English if u dont understand 私はこの歌が大好きです it said I love this song

@xUniq

6 жыл бұрын

Hey I am 16 year old Dj/Producer I have made 12 songs . Need your feedback to improve . of not, have a great day and don't forget to be awesome! 😄😄😄

@user-py3px8hk2u

6 жыл бұрын

DJ AG 最高です

@ohsunwon

5 жыл бұрын

Melody too

2017: Kyrre: Hey, can I remix "Tired"? Alan: Sure, go ahead 2018 Alan: Hey, I think it's my turn, let me remix "Stranger Things" will ya? Kyrre: Of course, why not

@adhityadn6068

3 жыл бұрын

🔥🔥🔥🔥🔥

@EmmiKitta

3 жыл бұрын

O.O

@user-xu6ne7vu7g

2 жыл бұрын

Fair

@yunho0128

2 жыл бұрын

dont you mean kygo

@javinkapur3227

2 жыл бұрын

Its Kygo

Kygo and OneRepublic made an amazing song Alan Walker made it legendary ✨

Alan Walker was wearing a mask before it was cool, what a legend

@kix_501st

3 жыл бұрын

😂😂😂

@ajcook7777

3 жыл бұрын

Oh trust me wearing a mask because of an airborne viral disease is NOT cool, not at all...

@kix_501st

3 жыл бұрын

ajcook7777 r/wooooooosh

@JesseGod1

3 жыл бұрын

cause hes ugly hes no legend dont get it mixed up

@kix_501st

3 жыл бұрын

J Wang he's probably better looking than you....but i'm positive he more legendary than you....AW ❤️

Why everything Alan Walker is soo perfect??😍

I remember listening to this song im Middle school. Best song ever. Still listening to this day.

@anandv5169

Жыл бұрын

Me also

@Blackcat34756

Жыл бұрын

Found it in high school but similar experience

@CubicPlanets

Жыл бұрын

Hi

@fernycatnoir.1913

Жыл бұрын

@@CubicPlanets ?

@CubicPlanets

Жыл бұрын

@@fernycatnoir.1913 Just saya Hi :)

It’s May 2024, let’s see how many more legends are listening to this song💙

Happy Valentine's Day, Walkers ♥ ♥ ♪ ♫ Desde Ecuador

@duban.monrroy023

6 жыл бұрын

Sandy García 👌✋

@armylover-2398

6 жыл бұрын

🇪🇨

@gaborkovacs8323

6 жыл бұрын

Sandy García thanks😘

@jandryaldair6137

6 жыл бұрын

💛💙❤

@ztoplay7

6 жыл бұрын

Sandy García x2

kygo , one republic and Alan Walker on a single song.....😭😍🤐🤐🤐🤐

@gogon2446

6 жыл бұрын

SAarthk hey check out my channel

*Dear person who may be reading this* . . 👇 *I wish you a beautiful life abundance and health*

👇 if you love Alan Walker

*_Kygo + One Republic + Alan Walker = Incredible perfect_*

@Tipusultan-jw6wu

5 жыл бұрын

TheKingMeme' you're right man

@levu9028

5 жыл бұрын

YES MAN

@bluebaron3618

5 жыл бұрын

NO IT EQUALS ULTIMATE MAGIC

@cwris

5 жыл бұрын

@@levu9028 emqeqwgmwgemqtmrhfemqheqtemrmqeqtqhqmmeermrkqqgmfemqgeememmiemeqmqemqmqehlqeqrfemqhqgeqgjemqqtmtqgheweqqgwfqemefejjehqqtqmjqmwg que#

@simplyz119

5 жыл бұрын

They should make a song like that.

Kygo and onerepublic in one song😍😍 then alan's remix man its lit...😍😍 Best valentine gift😍 Walkerzzz rock😉😉

@canaldosprimos2191

6 жыл бұрын

Savitri Paliwal youo

@clxudy69

6 жыл бұрын

Omg Alan liked your commenttt

@snitchell3563

5 жыл бұрын

Orang mana coy ?? :V

There's some magic in Alan Walker's music that makes everything lit! Even the remixes have more views than the original. It's called warmth. He knows exactly how to make a song better.

@sridharsasirekha

3 жыл бұрын

Soooo true bro😉😉😉

@alvitodev

2 жыл бұрын

Lead synth is his key

@wyattsean6872

2 жыл бұрын

Wow jenius

@l05tl1ght

2 жыл бұрын

I agree!!!!

@dally_A8

2 жыл бұрын

Right he I soooo special

Just wearing my headphones, closing eyes and being lost...

@percivaljr.paranas

3 жыл бұрын

Yes

@ilhamalamsach5798

3 жыл бұрын

how u write it then??

@pranjal789

3 жыл бұрын

@@ilhamalamsach5798 😄I just wrote my feelings

who else alone today? :c

@Nintorii

6 жыл бұрын

You are not Alone ;) :D

@user-ed2xb3ey4r

6 жыл бұрын

Michael Urban hey hey meeee😂😂me with food:):)

@lolghostlol2841

6 жыл бұрын

Michael Urban yo me

@Feritycentral

6 жыл бұрын

I am but it's not bad

@elisesku

6 жыл бұрын

Alone Alan Walker LYRICS Lost in your mind I wanna know Am I losing my mind? Never let me go If this night is not forever At least we are together I know I'm not alone I know I'm not alone Anywhere, whenever Apart, but still together I know I'm not alone I know I'm not alone I know I'm not alone I know I'm not alone Unconscious mind I'm wide awake Wanna feel one last time Take my pain away If this night is not forever At least we are together I know I'm not alone I know I'm not alone Anywhere, whenever Apart, but still together I know I'm not alone I know I'm not alone I know I'm not alone I know I'm not alone I'm not alone, I'm not alone I'm not alone, I know I'm not alone I'm not alone, I'm not alone I'm not alone, I know I'm not alone

"castles glitter under Spanish skies" WOW the way he says it is so beautiful!!

@vishwas4651

6 жыл бұрын

Yeah!!!

@musicbykes1753

6 жыл бұрын

One republic😍😍😍😍

@fred179

6 жыл бұрын

Ryan Tedder ❤

@spectrablade7473

6 жыл бұрын

Its so catchy!!!

@ilovigaanin9812

6 жыл бұрын

Its so goooood!!

Agust 2023 anyone?

@themoonlightinthesky1966

5 ай бұрын

2090😂😂😂

Fans: Listen once or twice Legends: Keep listening for ever cause this so is epic Which one are you?

@adityanair7342

3 жыл бұрын

A legend

@mystic_allie2633

3 жыл бұрын

Nice cause LEGENDS NEVER DIE!

@ZapDon777Music

3 жыл бұрын

Legends ;)

@Xtroblades71

3 жыл бұрын

LEGENDS

@ryanlarrysammy5106

3 жыл бұрын

So true👍

*E X E L L E N T*

The most beautiful part is *Castles glitter under spanish skies* 👍

@Alpha456

6 жыл бұрын

vinit payal woah alan loved your comment

@VinitPayalmusic

6 жыл бұрын

Alpha Gamer yes bro

@Alpha456

6 жыл бұрын

vinit payal u r Indian I 🤔

@051ozapuravmihir2

6 жыл бұрын

I started thinking U were the original Martin Garrix than I noticed ur name😂😂😂

@VinitPayalmusic

6 жыл бұрын

Ultra Nova lol

The lyrics just popped up in my head, and I remembered "Spanish sky" 😂

@artyom1264

4 ай бұрын

I can’t even remember the lyrics and everything in my head are just the melodies 😭

Back when covid was nothing 😓

If Alan walker remake any song ... It's greater than the original..... Lub u walker

Alone for the Valentines day

@nahitguetta6752

6 жыл бұрын

agree with u

@bicrowave32

6 жыл бұрын

... same. :(

@francesca1886

6 жыл бұрын

Elvis 楷森 **im not im not aloneee**

@way2tired2wakeup

6 жыл бұрын

same

@BINOOT

6 жыл бұрын

Plus one

Hello it's me...listening to this song in 2023 September... I am write this comment so that whenever someone comments or likes this , I would still get notification after 10 yrs and it will remind me to hear this song...Love this song and love u guys❤️❤️

Kygo ❤

The best part of the song is *"Castles glitter under Spanish skies"*

@immo0

6 жыл бұрын

LOL

@ZordGamingOG

6 жыл бұрын

yeah.. agreed

@hrk635

6 жыл бұрын

√

@virtualself4091

6 жыл бұрын

True text

@savage3690

6 жыл бұрын

💯💯

Those who are alone on valentine's day, remember that you are not alone. We got each other, and this remix here, we are united. One team, one person, one unstoppable force. Walkers unite!

@Shawn-bp7ol

6 жыл бұрын

Lightspark i know im not alone! -Alone(AlanWalker)

@emiwalker5604

6 жыл бұрын

Lightspark Well said

@saritabhardwaj203

6 жыл бұрын

We all r walkers and a team .

@aihayasaka6916

6 жыл бұрын

I never feel alone cause i have the Walker

I’ve been looking for this song for ages. I discovered this as a young child and i finally found it in 2023. i love it

2024 who still listen this masterpiece ✌

2018?🔥

@Siddiqq_

6 жыл бұрын

Callan Kemp Bruv this came in just now

Awesome remix i love you Alan Walker

@nazarethvaldez1213

6 жыл бұрын

Me too!

@Sraniewbanie489

6 жыл бұрын

@nicholas wira angkasa xdddddd

@dztrjrsoto321

6 жыл бұрын

Yes Best Nation I love

@dztrjrsoto321

6 жыл бұрын

Best Nation

@chiwapansurinwaranggool981

6 жыл бұрын

❤️

Who is still listening this masterpiece..❤️

March 2024 anyone? 😂

@ARLES-416

2 ай бұрын

i am😊

@emapesek1965

2 ай бұрын

@@ARLES-416 🥰

Walkers join!😍

Alan walker + Marshmello = DONE Alan Walker + Kygo = Done Alan Walker + K391 = Done now i want a Alan Walker + The Chainsmokers !!

@willanderson6603

5 жыл бұрын

Nope!

@myanhtran4197

5 жыл бұрын

how about Alan Walker + Katy Perry

@hxngxd

5 жыл бұрын

Alan walker + Pewdiepie !

@aeronautkelly499

5 жыл бұрын

Shashvat coool and want bebe rexha

@heyitsankita7221

5 жыл бұрын

I want Alan Walker + Sia. Thats a legendary combo.

🎵⭐ " We look for *Stranger Things* cuz' that's just who we are " ⚡🎵

My whole family knew that this was an Alan Walker remix as my headphones switched off. Whole Family!

"Castle glitter under spanish skies" *1630 Flashbacks*

@user-rk5cx2vu8l

4 жыл бұрын

I know right?

@EDMbubble

3 жыл бұрын

Assassins creed 😍😍 It reminds Me 1500

@Senokov

3 жыл бұрын

@@EDMbubble Wowiee! Ive forgot to play that game ive used to play Assasin Creed in my PSP

@EDMbubble

3 жыл бұрын

@@Senokov haha Me In My Pc 🙂

A song called "Stranger Things", made by Kygo, featuring OneRepublic, and remixed by Alan Walker... Have I died and gone to heaven?

@FrancisOno777

5 жыл бұрын

Yes yes you have. Also casually replies one year later

@rahulbhardwaj3668

5 жыл бұрын

@@FrancisOno777 And someone like your comment 1 year and 1 day later.

@erikysilvagomes5496

5 жыл бұрын

I thank the same

@danielalt7054

5 жыл бұрын

eriky silva I think I broke it but still liked

@aelyn57

5 жыл бұрын

I've been shucked and gone to heaven~ Minho, The Maze Runner 😀

Ok I officially love this song

@Phoenix-Products

Жыл бұрын

Love ya guys

"castles glitter under Spanish skies. I'm just looking out for you tonight" All ways makes me think of him....❤️🎶

Please make a new version of FORCE!😉😀

@facs27

6 жыл бұрын

FF I wait a restrung version of “the specter” or a “force” version whit letter (sorry for my English I’m Chilean)

@skybluenecktie7258

6 жыл бұрын

Oh my God, it is confirmed! He will do it!

@Florian_ft

6 жыл бұрын

SkyBlueNecktie really???

@skybluenecktie7258

6 жыл бұрын

FF Because he hearted it lol

@Florian_ft

6 жыл бұрын

SkyBlueNecktie omg i didn't see

This song is never get old

Original - 39M Alan walker Remix - 44M ❤❤

@ParadoxPerson02

3 жыл бұрын

:) Nice

@galaxyshorts3039

3 жыл бұрын

Да

@creationcastingjd8875

2 жыл бұрын

But original was better ❤️from my opinion

@TheSkiesHasFallen

2 жыл бұрын

@@creationcastingjd8875 both are equally nice for me

Awesome 👌🏼

@kamillimakgames

6 жыл бұрын

Pro Launchpadder Oh hi there

@maxiramirez4489

6 жыл бұрын

Hola perros

@josedavidgutierrez3273

6 жыл бұрын

Hola prro :v

@orrionn.

6 жыл бұрын

Pro Launchpadder I never think, one day, i'll found you here!!

I just usually hate remixes,Because it ruins sweetness of original song But honestly when this guy remixes the song.... i m just wow!!!! Dont know what is the magic in this guy's music style....

@Shawn-bp7ol

6 жыл бұрын

Fadadu Harshad its called awesome extraordinary amazing epic crazy good skillz

@nonceslayer6918

6 жыл бұрын

Rohil Bhattacharya boi it's probably not his first language

@walker9961

6 жыл бұрын

Fadadu Harshad I feel exactly the same

@daixiee

6 жыл бұрын

Rohil Bhattacharya do you English LMAO

@ridz920

6 жыл бұрын

SAME!

This generates a lot of nostalgic feeling 😭😭😭

Me in 2023 still listening this song ❤

Happy Valentine's Day, Walkers! ❤️

@Lorenzo-ng7ll

6 жыл бұрын

Top Songs World Mostly if you pass it alone!! ❄ ❄

@brilliantmisfit_

6 жыл бұрын

Lorenzo yeah, like me! XD ❤️

@thepaulis6898

6 жыл бұрын

Cute

@Lorenzo-ng7ll

6 жыл бұрын

Top Songs World where are you from man?

@brilliantmisfit_

6 жыл бұрын

Lorenzo Poland :)

Alan Walker and kygo 😍😍😍❤❤❤❤❤❤

wtf bro the alan walker beat goes perfectly with the lyrics

DON'T WORRY JUST THE VIEWS ISN'T HIGH BUT, THE SONG WON'T DIE IN ANY ERA💎...

Happy Valentines Day! ✌ And awesome remix❤❤

MY NAME IS LILY I'm FADED . I'm ALONE I'm TIRED I LOST CONTROL So SING ME TO SLEEP. When it ALL FALLS DOWN. Into the DARKSIDE. With the FORCE of the SKY. A ROUTINE to IGNITE. THE SPECTRE of unbreakable DIAMOND HEART. And I'm ON MY WAY to THE DIFFERENT WORLD! traducción : MI NOMBRE ES LILY Estoy desvanecido . Estoy solo Estoy cansado PERDÍ EL CONTROL Así que cántame para dormir. Cuando TODO SE CAE. En el lado oscuro. Con la FUERZA del CIELO. UNA RUTINA PARA ENCENDER. EL ESPECTRO del CORAZÓN DIAMANTE irrompible. ¡Y estoy EN MI CAMINO hacia EL MUNDO DIFERENTE!

@harountoumi8963

4 жыл бұрын

Amazing 😍😍😍

@flamma9034

4 жыл бұрын

Where is Live Fast !!!

@xfvrfd4350

4 жыл бұрын

Nicely done

@maryflornamoca5099

4 жыл бұрын

Wow

@arnulfozamorano5050

4 жыл бұрын

when a Norwegian remixes the product of another Norwegian, the result is beyond legendary

This song gets stuck in my head over and over throughout the years it's been out. This has more depth than the original and matches the lyrics a bit better depending on if your outlook is more positive.

Castles glitter under spanish skies I'm just looking out for you tonight We use to run around this ghost town Always thinking out loud How we gonna get out I remember We dreamed of places we could go Castles with a strange glow People that we don't know I remember We left a life that's ordinary from the start We looked for stranger things Cause that's just who we are Found me the edge of something beautiful and loud Like i'm picturing now Castles glitter under spanish skies I'm just looking out for you tonight Snow white mountain in a foreign state Tell me someday we'll get there I see a technicolor shadow Underneath your window Just in case you don't know I can see it You cast an unfamiliar day glow Different then what I know Shining like a halo I can feel it We turned our backs on ordinary from the start We looked for stranger things Cause that's just who we are Found me the edge of something beautiful and loud Show me the sky falling down Castles glitter under spanish skies I'm just looking out for you tonight Snow white mountain in an ancient place Tell me someday we'll get there Castles glitter under spanish skies I'm just looking out for you tonight Snow white mountain in an ancient place Tell me someday we'll get there Now you can see the lyrics while scrolling down the comments, thank me later

@matthewyoung4191

6 жыл бұрын

SpectraBlade thank tou

@wellzer4612

6 жыл бұрын

Thank you

@-minyoongi1722

6 жыл бұрын

SpectraBlade thank youuu

@doctortempest56

2 жыл бұрын

Thank you much Spectra!

@FrankieplayzWasTaken

Жыл бұрын

thank u

*friend*- what’s your favourite song? *me*- Stranger Things *friend*- Nono SONG not SHOW! *me*- 🤦🏼‍♀️

@icyfriday8571

5 жыл бұрын

Omg same lol

@onepunchman1953

5 жыл бұрын

Waiting for season 3.....

@Progamer-xq5ce

4 жыл бұрын

Ikr same thing happened to me my entire fucking class including me are addict to that fucking netfleix show we can relate coz we are a bunch of 15yr old douchebags

@jakehardy1548

4 жыл бұрын

@@onepunchman1953 season 4

@onepunchman1953

4 жыл бұрын

@@jakehardy1548 Now we gotta wait one more year....

It sure takes me back in time and I hate that I can't do anything but shred some tears and cherish those moments. Thank you Alan!

@monke8083

2 жыл бұрын

Same bro.

@Randommtf

Жыл бұрын

calm bro there is still some good music out there have you try lonely world from k-391. and it's not like the good time has passed, fast foward 2 years later you will be here again cherish this moment you used to considered as the end of those good time so don't be sad keep your head up and look forward to the future it got alot in store

@nightcore_21

Жыл бұрын

@@Randommtf Thanks mate for this!

@takeuchi5760

Жыл бұрын

@@Randommtf that's beautiful

This version is much better than the original

@Jav02

Жыл бұрын

NO WAY! The original is art, this one too but here one has its charm

So this is a v*ALAN*tines Day gift from Alan to walkers.. thank you! 👍🏼❤️ Walker # 5046

@bluegold9732

6 жыл бұрын

lol

@magic_relic2429

6 жыл бұрын

Vidhi Ghai yes

@the.young.psychologist

6 жыл бұрын

Ana Casper yes! How do you know? 😂😂 amazing to find u here!

@the.young.psychologist

6 жыл бұрын

Ana Casper oh, well even I recognised you! If you want you can tell me your username so that I can follow you :)

Alan walkers remix = Pleasure to my ears!

This song really remember my past girl my love i hurt because she love me but she married because family . And. After i cant see girl like that again 😢

THOSE LOCKDOWN DAYS❤

I love ALAN WALKER

@andrashuszar8837

6 жыл бұрын

"I'm not alone"🎵🎵

@Idontknow-qj5ck

6 жыл бұрын

You probably know him because every person uses his songs in their videos

@ineszarazua6918

6 жыл бұрын

Tanis Extrem igual yo!!!

@ztoplay7

6 жыл бұрын

Tanis Extrem también el mainkra como veo v:

@gustavocarrizo9225

6 жыл бұрын

Hello amigo

Everything that Alan Walker remixed it will be more better... That truth

@kohjitming7693

6 жыл бұрын

SilentKiller AF true

@AL-hk3oo

6 жыл бұрын

More better?

50 000 people used to live hear, now its a ghost town...

OH yeah 2022 men, what an amazing remix!

OMG good

@MrKundu-vp7td

6 жыл бұрын

fan Alan walker , Happy Valentine's Day! 💖

@kacperlewczuk842

6 жыл бұрын

fan Alan walker happy day

@fanalanwalker8508

6 жыл бұрын

Thanks Ms Nandalal kundu

@fanalanwalker8508

6 жыл бұрын

Kacper Lewczuk thanks

July 2019 : - Original song : 27m views - Alan Walker remix : 35m views Edit : 1k likes... O_o

@kierataylor2089

4 жыл бұрын

lol

@bachlamtung5131

4 жыл бұрын

wait for real?

@mstormarise9375

4 жыл бұрын

Bách Lâm yeah! Go and check out the original song and see for yourself!

@ReD-lh3jv

4 жыл бұрын

Now 221 likes lol, and yeah... Alan Walker is just great 🔥🔥🔥

@mstormarise9375

4 жыл бұрын

@@MahmoudFadl well most if not all songs are better than the remixes :/

This song kinda explains my life right now. I really like it. It's one of my only safe places

@kurteisner67

2 жыл бұрын

Same, same. Hope you're good, best wishes.

@sapluna6514

2 жыл бұрын

@@kurteisner67 same to you!

Is There anyone in 2021 ... Love you Alan Walker .

Omg eres una maquina con esas músicas electrónicas alan eres el mejor

@mushroom1143

6 жыл бұрын

DiErMiDa si el es el mejor me encanta su musica como me gusto mucho all falls down jaja😃

@dravyaprakash1888

3 жыл бұрын

Hmmm now alone tell me

Kygo and alan walker!!! Omg😘😘😘😍😍😍🖤

Never forget this song

5 years gone so fast I just remember when these song just realease I was waiting and then 5 years past like some wimd. What a Nostalgia.😢😢

I'm a walker since 2 yrs now.. and if Alan loves this comment I'll jump off my roof and keep jumping on all falls down

@balahibo

6 жыл бұрын

Vidhi Ghai me too

@kennyralph7290

6 жыл бұрын

I hope he loves your comment ;)

@IsratJahan-yp4dj

6 жыл бұрын

Vidhi Ghai awww so sweet 😊

@the.young.psychologist

6 жыл бұрын

KennyRalph thankyou 😃💕

@the.young.psychologist

6 жыл бұрын

Israt Jahan 😃💕

Happy valentin you Alan walker

This is better then the original

Amazing memories

Holy guacamole, this is the holy trinity of music right here you guys 🔥

Better than original one...

@kaushikdas3474

6 жыл бұрын

SilentKiller AF no broda!

@maxymsong242

6 жыл бұрын

No no

@HawkyMagix

6 жыл бұрын

I agree

Made me nostalgic

It's 2 years and i feel like a lifetime, those days...

I'm amazed how Alan turns cool songs into masterpieces ! Genius !!! Look forward to continuing

@VNSA5504

4 жыл бұрын

He turned a masterpiece into a cool song in this case.

@fadde7587

4 жыл бұрын

He turned a masterpiece into a legendary diamond

@mohamedziyan1091

3 жыл бұрын

He redid a masterpiece into an okay song the original was far better no hate tho I love them both just stating facts

@samiahmad5987

3 жыл бұрын

You guys just want bass and beats in every other song, you'll never understand the beauty of the original version just because you just don't have a taste !

@adityanair7342

3 жыл бұрын

@@samiahmad5987 I do.. the original song's so beautiful too.. But I like this one cuz I have a taste for his signature 'Walker Pluck'