There is a vaccine against myxomatosis. It's called Nobivac Myxo-RHD Plus.

@zapicoreymarl.418

3 жыл бұрын

Thanks sir

@zapicoreymarl.418

3 жыл бұрын

Thank you very very much 💕

@Max23465789

3 жыл бұрын

In the United States it costs about $6000 to treat 100 rabbits for one year," you have to re-dose annually ." aetapet.com/how-much-do-vaccinations-cost-for-rabbits/#:~:text=the%20get%2Dgo.-,How%20Much%20Will%20You%20Pay%20for%20the%20Rabbit%20Vaccination%3F,Myxomatosis%2C%20which%20is%20another%20%2420.

@King-oo9ei

3 жыл бұрын

kzread.info/dash/bejne/fmt3sKRth6qaZtI.html

@jeffharris96

3 жыл бұрын

Except this is not Myxomatosis, or if it is it’s the first ever case in the Philippines, much more likely to be ‘Snuffles’ can be avoided by better husbandry and well ventilated housing... hence Dexters rabbits don’t have it.

Sir Dexter I have been a doctor for more than 30 years, and I am always impressed with your knowledge of veterinarian medicine. The care and love you provide for your animals is apparent. The smart man always treats his investments well, and therefore enjoys the fruit of his labor. I love watching your videos, I always learn something from them. You are truly a philanthropist Dr Clark

@felixfelix2576

3 жыл бұрын

Pretty sure he has a very on staff. He can't know everything.. plus he is wealthy.

@yumikawi8816

3 жыл бұрын

You truly love animals

@uchibauki2515

3 жыл бұрын

Because it’s easy to buy medicine or even vaccine in other countries without doctor prescribed it, here in America everything has to ask doctor that’s why very costly just to have dogs cats also rabbit, we feel robbed by the vets, sorry but that’s true😓

@hannatjiehangula7556

3 жыл бұрын

@@111119jai qqqqpl

@theprof73

3 жыл бұрын

I know more than this yokel and actually give sanctuary to rabbits instead of exploiting them.

I'm glad that you gave that youngster an opportunity to talk to us. It's will help them to grow whenever they decide to follow your footsteps.

@alisonshanahan9529

3 жыл бұрын

He did so well, very articulate and to the point.

Glad to see one farmer helping another. Says alot about your character. May God bless you in all your life.

@Legoldos

10 ай бұрын

blessing for someone who have rabbits on wire flooring, thats a torture and deserves curse not blessing

I wants to move to the Filipines, because y love animals. I envy you in a good way, God bless you all. From Rep.Dominicana.

@astigmatv3749

3 жыл бұрын

Hi can u please help me i want too build a rabbit farm too. I just need sponsor because i have no budget. Thank you

@justinereyes7820

3 жыл бұрын

@@astigmatv3749 sa 1k may pair kana

@ramachandarbehera1958

3 жыл бұрын

@@justinereyes7820 noooo

@saranghaeboy2430

2 жыл бұрын

Not really. Don't expect too much

@altafshekh837

2 жыл бұрын

@@justinereyes7820 58

Ivermectin is great stuff, I use a drop of the liquid on the back of my birds heads to get rid of parasites. My dogs get it too for ticks and fleas. I recently watched your video on fumigating your farm to get rid of mosquitoes, seeing the state your neighbours poor rabbits were in due to lack of fumigation was a shock. Your insistence on prevention and your shoe washing station at the entrance of every building is certainly paying off. No big vet bills or animal losses for you! You are teaching a new generation the importance of cleanliness, of making sure the animals in your care have the best life, food, fresh water and shelter. You teach them the value of the work they are doing, how much they can earn by producing high quality products in top condition. This is why your website is growing worldwide, nobody else is doing what you do. By the way, I love the bamboo fences, they look like they should be on an expensive country estate, they are sensational, congratulate your builder on his excellent job.

I can see that you really care about the animals you're raising but please hear me out. Water bottles, Water bottles are not adequate for rabbits as it's very difficult for them to be able to get enough water, especially since they're designed to only let one or two drops out at a time. Rabbits drink as much as a large dog and require a large water bowl available at all times. I did notice that you have some water bowls but please throw away the water bottles. Mess flooring, Wired or mesh flooring can cause sores on a rabbit's feet, they're known as sore hocks and are very painful for them. Hay, The bulk of a rabbit’s diet should be hay, this should be accessible at all times in unlimited quantities as it keeps their guts moving. Hay consists up of 80% of a rabbit's diet and should NEVER be skipped out on as they're likely to develop GI stasis or other health concerns. Also please look at proper guidelines on how to pick up a bunny here on KZread. Please also don't forget about how many rabbit's are at shelters needing homes. Millions of Rabbits are euthanised every year due to them not being able to find homes.By breeding rabbits you're contributing to the overpopulation of Rabbits. Please take into consideration on what I've said, especially the point I made about hay as it's crucial for their diet :) Sidenote be careful about mixing up the kits, I'm assuming a lot of them were weaned and seperated but for the kits that you put back with their mother's you don't want to mix up their scents or the buns as the parents could end up killing them

@knkfarm8660

2 жыл бұрын

I own a lot of animals and I do research about them before getting them so I know what to do and how to care for them. If it's a situation where they need to be rehomed immediately and no one will get them and you have space for them get an area set up for them and get them home then do research about that specific animal/pet and then get their pin/cage set up properly. I would love it if people can do research for the animals so they know how to properly take care of them. holding bunnies, The way he is holding the bunnies is not ok. Holding them by the back skin/fur can seriously harm/hurt them. How to properly hold them: Placing one hand under your rabbit's chest. Place your other hand under their hind legs. Lift your rabbit and hold them against your body to keep them nice and secure, but don't squeeze too tight. Temperature, If it's to hot outside for bunnies they will have heat strokes and die, what you can do if it is to hot outside is put ice in their water and give them shade. If it's too cold they will freeze to death, what you can do if it's to cold give them hay, hideaway, block the cold wind with a tarp. Food/water, Hay and fresh grass is 80% of their diets, water bottles should be thrown away and replaced with water bowls. Give them fresh cold water every day. flooring/living conditions, The flooring is not ok the wire can cause sore hocks/ bumble foot which can cause pain to the bunnie. Bunnies should have some sort of hideaway so they can hide from the sun and keep warm, some wood to chew on to keep their teeth short so they don't grow to long and cause pain, something that can shorten their nails, at least half the cage needs to be solid flooring so they can have a break from the wire.

@aamichael4628

2 жыл бұрын

@@knkfarm8660 very informative. Thanks.

So cute rabbit 🐇

Hi uncle dexter im a rabbit breeder and i started breeding rabbits when i was 12 years old and now im 19, i can produce 20 rabbits a month. I hope I can be successful just like you someday.

@nayigabrenda7400

3 жыл бұрын

Yes u can be successful just believe in yourself

Your helpers are impressive. They work hard and I see that they are glad to work. It’s also good experience and attitude that you give to them. One day they will also be good farmers.

@alisonshanahan9529

3 жыл бұрын

I too am impressed by how willing and how hard they work. They respect Dexter and he respects them in return, no wonder they work so hard for him.

Dex, the reality is that nothing is without its trials. Thankfully hard working folks such as yourself help us all to achieve success :)

@DextersWorld

3 жыл бұрын

Good day to you my friend hope all is well with you michael.

@annalynsantanez3227

Жыл бұрын

Binebenta po ba yong rabit

Super super super vella flm te gjithve ju dimofte ZOT ZOT vella flm ZOT

Nakakatuwa andami nyo po rabbit, sarap panoorin, galing nyo pa mag english, very clear and correct grammar 😊😊

Plant Rosemary around your rabbit pens. Insects hate its fragrant smell it leaves in the area. When you prune the rosemary back, take the stems and rub them on the cages outside or the rabbits being attacked. the rosemary oil will act as a natural repellant. It also works on people when you rub it on yourself.

@abdoulieceesay1155

3 жыл бұрын

hi

@prossyprossy5460

2 жыл бұрын

Thank you darling 💕 🌹 for the good heart ♥

@prossyprossy5460

2 жыл бұрын

May God bless in Jesus name 🙏

@kunledare316

2 жыл бұрын

Hi

@kunledare316

2 жыл бұрын

Like the vid

FYI this is unlikely to be Myxomatosis as it’s never been reported in South Asia, if it is then it results in 99% death in European rabbits. Possibly Pasteurella (Snuffles) which is a bacterial infection brought on by stress, overcrowded conditions and poor ventilation. Treatment has variable success depending on the severity of the symptoms. You can use an antibiotic called enrofloxacin, orally for up to three months, followed by probiotics to restore beneficial gut bacteria. This is why your very well designed rabbitary is great fro them. 🙂 Also, while picking up the rabbits like a handbag may be convenient it really isn’t the right way to do it, they should always be supported with a hand under the rump, grabbing a handful of skin is painful and can separate the layers of skin from the muscle underneath.

@missyrabbit5250

3 жыл бұрын

BunnyVac is a Pasteurella multocida vaccine for use in healthy rabbits . We vaccinated our rabbits with good success.

@soxpeewee

2 жыл бұрын

Baby rabbits have a ruff like a kitten to grab

the best thing in this channel is he always speak English...that is why many people will watch from all over around the world

Türkiye den Konya Kulu dan selamlar çok güzel olmuş teşekkürler tenkyou tak amazing Maşallah Sübhanallah beautiful admire tenks teşekkürler

GREAT STUFF DEXTER - IF YOUR WHOLE ISLAND HAD A HAND IN AN ANIMAL TRADE AND AN CROP TO EACH DAY WOULD BE A BLESSING AND MORNINGS COULD START WITH CHORES FOOD AND SPARRING AND DUELS - THEN A TRIP TO SEE THE ELDERS FOR MORE GUIDANCE THEN HOME VIA FRIENDS AND MARKETS TO ATTEND TO THE FAMILY HERD - GREAT STUFF DEXTERS WORLD

I am so glad there are people like you in this world ☺️☺️☺️

@gisella.antuanethsandovalr1791

3 жыл бұрын

Nono

@iona5439

2 жыл бұрын

Why... hes going to eat the rabbits

Sana po dumami po yung magalaga ng mga rabbits. Good alternative food source and good animal companions. Nahahati mga opinions namin when it comes to legal rights of rabbit meat. Thanks po for the infos 😊

Super galing mo po sir...idol ko po kayo..pati sa mga goldfish at koi..god bless

I have never seen rabbit dens underground! What a great idea! It's cooler and they have more privacy. All of your farm looks so nice and clean! :)

I really love this vlog,I am also have 3 rabbits and I love them so much💕hoping I have more rabbits

Nakakatuwa Naman po Ang kasipagan ninyo sir! 🙏💪😊

Thank you DEXTER YOU ARE SUCH A GOOD PERSON WITH GOOD HEART TO SHARE OTHERS .

Sir dexter u are my inspiration to keep on petting fish and taking care of them I use your tips on how to care for fish and Betta ty for inspiring us

WoW friend love from india,chennai - your words are so TRUE and gives POSITIVES vibes so nice of you great HUMAN so blessed always like this forever great keep going...

Ang sarap hingin nung yellow na rabbit. Cute cute!!!

Excellent explanation, this channel is surely helpful to everyone that have their own livestock. Thank you

Man, you seem like a nice and passionate guy but my heart breaks for these bunnies.

@sharongraven

3 жыл бұрын

Why...? He’s actually doing 10x better than about 80% of rabbitrys I’ve seen. Most don’t even give veggies :(. They look healthy and they all have sunlight except for the ones raising kits.

@willdwyer6782

2 жыл бұрын

This guy's running a decent meat rabbit operation. His neighbor, on the other hand, is doing everything wrong. His neighbor's worst offense is allowing his birds to come in close contact with his rabbits. That's most likely why his rabbits are sick with pasteurella.

@joaobosco177

2 жыл бұрын

qpgslgaldelgaphalgwkdfllelfmiwphwlmslfkwlls

@quvonchbek7306

2 жыл бұрын

🦡🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🐤🐤🐤🐤🐥🐤🐤🐤🐤🐥🐥🐥🐥🐤🐥🐤🐤🐤🐤🐥🐥🐤🐤🐤🐤🐤🐤🐤🐤🐤

wowww .... cool🤩 ... I really like rabbits. greetings from Indonesia🙏

@DextersWorld

3 жыл бұрын

Thank you very much!

@nathanchannel2531

3 жыл бұрын

@@DextersWorld 🙏🙏🙏

Hello Dexter world.you can inspire the farmers to take care of their pets

Tipp when u take the kittens away from the mother, let the smallest kitt stay with the mother for one or 2 weeks longer. It is less painful to the milk reducing processs for the mother and the change that she get mastitis is a lot less. Also give more real food minimum 3 weeks befor u take the kitten away, so they can learn. But im shure u do that. Good video, thank you ❣

Amzing rabbit hutch dexter really love the idea of providing privacy. Reminds me of my pet rabbits. I used to apply a lotion named ascabiol, very effective against this kind of virus.

Beautiful farm and animals, as fellow farmer i recommend you to put under the rabbits either straw, hay or residue of fine Wood after you cut Wood with chainsaw. Rabbits don't dwell on moist ground.

wow ang ganda sir..nagsisimula din po ako ngayon sa rabbit meron po akong magasawa sana dumami rin katulad diyan sainyo..

Salamat jud kaayo sa imuhang gitudlo sa akoa Sir Dexter nakatabang jud ka sa akoa na maka income ko ug ginagmay. Watching from Davao 17yrs old

I hope one day my dreams come true. Rearing rabbits Is my second plan I'm very passionate of it. When I was young we used to hunt it from the Forrest locally we call "Bakeyle" in Somalia🇸🇴. I appreciate your restless support

@skyblackholles5403

3 жыл бұрын

Somali waryaa qof soomaali ah lagama waayo meel kaste ee sxb soo dhawoow maxaad samay saa chenal kan waad soo booqatay ma xayawaanada ayaad xiisay saa sxb

@NHikam

3 жыл бұрын

@@skyblackholles5403 . Haa bro waxaanba leeyahay meel Poultry farm ah. Marka Dalka inaan dadka dunida ku nool barnana waajib ayaa naga saaran. Videos-ka aan sameeyo waad arki kartaa

@abdinassirmuhamed4492

3 жыл бұрын

Food security is very important walalkey and it starts from mixed farming or agriculture and dexter is a perfect example and I hope we benefit from him and better our lives in somalia. I'm a fan of dexter for a long time now

@skyblackholles5403

3 жыл бұрын

@@NHikam waan xiiseeyaa ee chenel kaaga magiciin intee ka daawan karaa chenal miyaad lee dahay

@NHikam

3 жыл бұрын

@@skyblackholles5403 . Kan ama Tahrib-did Poultry farm. Thanks

This the best channel I have seen so far

Love the way of your rabbitery ♥️❤️♥️♥️❤️😍😍

@DextersWorld

3 жыл бұрын

Thank you! 😊

Ang cute po nila🥰 parang gusto ko n din mag farm ng rabbits 🐇

I really wish you would place blankets or hay at the bottom of the rabbit cages, the wire is really bad for their feet and can cause sore hocks, they are very painful for them

@MattrixNY

3 жыл бұрын

The problem with that is then the rabbits poo all over the bedding and they end up walking in their own filth, which is also bad for them.

@clairah8700

3 жыл бұрын

@@MattrixNY Well they can at least clean their cage once a day instead of hurting the rabbits. Seems like they don't really care about the bunnies

@madbrawler4398

3 жыл бұрын

That’s why i can tell that this idiot guy knows nothing about the proper way of handling rabbits..

@chanellethomas6886

3 жыл бұрын

@@madbrawler4398 Also there's no hay I'm surprised they're still alive honestly :( The troubling thing is how confident he sounds about how he's treating them, I must admit the way he picks them up rubs me the wrong way

@amandaengelman5168

3 жыл бұрын

Many breeders keep them on wire with no issues. Having them sitting in their filth is much worse for them. Rabbit pellets are a complete diet. Many breeders never give hay and their rabbits live long, healthy, productive lives.

Thank for the update sir dex.....rabbit farming is so nice...hope you also lift us small backyard farmers....thank you and more power...

Kol dexter very nice po ang raising methods nyo po i also a fan of raising rabbits... Godbless po dexters world

Thank you oo mayron sailong yon ang limalagay ko langis pinapahid ko sa ilong vod bless you

So glad I found your channel! You're amazing with the care of your animals. God bless you.

@dioniciaacosta7134

2 жыл бұрын

C da gdh

@RubenDan-ml6ol

Жыл бұрын

Hello Megan, how are you doing today.

God bless you sir❤️❤️

Wow Thanks for sharing I am a Ugandan lady but I've loved the way you do your things

Siguro kapag ako may alagang rabbit.. di ko kaya silang katayin.. dahil sa napakabait nilang mukha ata ang cute pa nila

Well done Dexter

they so cute😍

الله يوفقك يارب ☘️🌹🌹🌹🌹🌹🌹🌹

I like rabbits and chickens that is why I always watch your videos.

Thank you so much Sir Dexter, I've been watching your videos, and I am starting to raise a pair of rabbits. God bless and keep on uploading videos.

@joaobosco177

2 жыл бұрын

Domingos.dlmdlnskndmhskhwlnskfdmgeknskjlvdlfdlgmdmdmdkhal pwpldldkjelmzlgodkdohi3or950ye0tieotyjrktktoynglgbmnslfmflflfldkgs

Hope there is less loss due to the flood. May God Bless everything abundantly.

@doitwelldoitself1194

3 жыл бұрын

Pls give me a subscribe

@kasozigodfrey9496

2 жыл бұрын

Hi mr Dexter I would like to get some knowledge on how to build underground rabbit cages . Thank you.

Nice business 🥰

Waaw.. i saw your all videos. So just i am replying in favour of all videos that you are one of the best man that you are making all your dreams come true.... Waaw... You are doing everything in your Life.. I also want to be there with you... But I missed you and that beautiful place...

Dexter, you are an awesome human being and we love watching your very informative videos and we love seeing how much you care about all your animals! God Bless you and yours, brother! From Tennessee, USA.

@DextersWorld

3 жыл бұрын

I appreciate that!

@jamalnasir5781

2 жыл бұрын

@@DextersWorld Which medication is being referred to inject the rabbits with? Can you please name it..

@HungTran-jk7lm

8 ай бұрын

Thỏ mẹ sắp đẻ mới nhốt dưới hầm đó hả a.k thấy cho nó ăn như nào .a chia sẻ thêm dc k ak.e thấy rất hay và đang muốn làm theo

Love from India..Fantasic info on the rabbit farming..one question from me, how do you clean the soil / ground after the rabbit and kitten are taken out . Do you actually clean it regularly like once a week ?

Hello I'm Katrina Holmes I love what you are doing with the rabbits this is love I have a rabbit name Ziggy he is healthy he goes to the litter box and have fresh water every day and rabbit pellets he loves taking a shower as well keep up the excellent service work love Katrina t

Yeah dextr is natural man👌🏿👌🏿👌🏿👌🏿👌🏿👌🏻

Nice video Dexter, good info about possible rabbit issues. Next year I’m planning to add rabbits to my farm stay. I’ll include it on my channel too. Not for meat, but for an attraction to the farm stay, adding manure and possibly breeding/selling bunnies. I love the colourful ones.

@jaimaruthi360techfeed8

Жыл бұрын

not for meat..lots of love and thanks

@mohammedawal9476

Жыл бұрын

Is good you are teaching us God bless you

Great work Dexter!

Wow kadaghan SA anak sang imohang rabbit oy sir Dexter God bless

Boss Dexter maraming salamat sa pag bahagi..san location nyo boss,.subaybay ko po channel mo at isa po akung OFW dito sa Qatar..may balak na mag buo ng sariling rabbit farm.thank you for sharing boss..

Please share to us how do you clean the maternity cages? Thanks ☺️

Such a good person and a hard-working person. I salute you Sir Dexter😊❤️

@iongitnomemes4383

10 ай бұрын

Dapat po bakal po ang kulungan ng Rabbit😅

Gush...sana all kuya dexter.share k naman ng mga alaga u po.yan din po pinakadream ko ang magkaroon ng maramin alaga na pwede kong pakinabangan.pagkaperahan at magbigay ng kasiyahan sa akibg sarili at sa aking mga alaga na din.sa ngaun po alaga q ilang rabbit,manok,baboy at isang baka at kambing.gusto ko sana magkaroon ng gaya ng meron ka kuya na alaga...lalo na ung pabo at ganso😁...

Sana kahit rabbit lang po ngayung pasko❤️❤️❤️

Wow, I want it. I love it.

I learned about agriculture and farming. Thanks much sir Dexter

@DextersWorld

3 жыл бұрын

You are most welcome.

@selvikabilar1017

3 жыл бұрын

1 rabbit

@selvikabilar1017

3 жыл бұрын

Mannarkudi website

I love to watch your show, I remember when you only started with Chickens.I would love to visit your country and enjoy your farming. I am in the USA, I have a few friends in the Philippines nice people.

Thank goodness..they're animal lovers, and the Rabbits are their pets. Love seeing all the different animals.

This is One of dream, but is infortunate, i can not realised It.

@humairakhan7413

3 жыл бұрын

Aww these are tooo cute۔۔۔ kzread.info/dash/bejne/pp5p2dmJn9ezhLw.html check this too

@bindithav4239

3 жыл бұрын

O also want a ton of fish And my favourite fish is betta But i can breed them but i can't grow them I dont know why I give them live food added almond leaves checked everything

Awesome farm Dexter! I thought you were raising rabbits for food. I have raised pigs and goats, but bunnies are too cute!!? You run your farm very well. It inspires me greatly.

@alisonshanahan9529

3 жыл бұрын

Rabbits taste wonderful. I grew up in country Australia in the 60s, everyone ate rabbit, it was the staple diet as it was free. It was a great shame when they released mixamatosis in the late 60s, a lot of people lost jobs and many families went hungry.

A very good system of keeping rabbits and managing their cells, food and medication. Pls keep us informed about other pets like swans, turkeys, chicken, etc.

Watching from Switzerland sir asawa ko nag enjoy manoud nang farm mo sir God bless you sir and family 🙏🙏🙏

How often do you remove the dirt from the maternal cages? And do they give birth on the plain dirt or do you provide some type of nest for the birth? Thank you.

Excelente video hermano siempre tienes algo muy bueno para nosotros saludos desde México te mando un fuerte abrazo y bendiciones para ti y tu familia

@DextersWorld

3 жыл бұрын

Muchas gracias hermano ohla tambien na buen salud tu y tambien tu familia. stay safe!

@ivanfisher5148

3 жыл бұрын

@@DextersWorld muchas gracias.

lahat naman ng hayop kelangan malaking lugar na magagalawan para bawas chansa magkasakit

Thank you so much Sir Dexter for your informative videos. It is very helpful. Just want to ask if how do you clean up the rabbit poops on the ground with the pregnant doe or do you just leave it there? Hope to hear your answer.

Why why they sooo cute 🥺🥺🥺

Sir dexter, maybe your friend must try to keep them a distance of his rabbitry and geese n ducks.

Thank you for the knowledge you give us.

Very good material thxs guys

Were are you gonna sell the harvested rabbits aside in your pet store sir dex..

I really miss my baby doe :( they passed away last month bcoz of that skin disease :(

तुम्हा सर्वाना ही पुढील भविष्यातील ससे माणसं असचं कापून खातील. तुम्ही नर मा स भक्षक व्हाल. दूध व भाज्या अन्न धान्य कधीच मिळणार नाही तुम्हाला!. आज ज्यांना तुम्ही खाताय तेच उद्या तुम्हाला खातील. आमेन! ,ॐ, , बुद्ध,येशू, शिव वामन, वामनशक्ती शिवशिवा, शिवा शिव, मासा नो बु फुकुओकाचं काड की जय! टोयोटो, बोकाशी, हिरोशी, टी कियोटो, क्योटो, यांच पुन्हा हिरोशिमा, नागासकी सह निःपात, निःपाक पानिपत होईल. हाय शाप पृथ्वी देईल तुम्हाला!

I love your channel Allah bless u

I love it 💟

Sir Dexter , Failure is nothing but the way to success 🤗

Verry close to hit 1million Congrats dexx

Very nice. Keep up the good work, you're doing an awesome I love rabbit meat. Pan Fried rabbit is the best.

Hi Dexter, I've been watching you for such a long time now. This rabbitry, my friend gave me a pregnant one due to deliver on the first week of August. May I ask where to buy the ivermectin? I am from 🇵🇭 too. Just in case I might need it someday. My kids loved the pets. Thank you for your information and experiences. It's quite inspiring 🤩

@mangaofelicidad4068

2 жыл бұрын

You can buy at LAZADA

@Denzkitv

Жыл бұрын

it is available in any agri supply because it is using also in other livestock

Also have u thought about making compost pile using pallets in or outside of ur chicken coop then eventually open the pallets and let the chickens 🐓 scratch and eat all the bugs and worms in it ? I think it will help cut food cost tooo

@L0_V

3 жыл бұрын

Paris Bray , yes I thought and seen the same technique with pigs... pig manure left in a pile with a tarp over it and left for a few days... then the tarp is lifted and the chickens eat off the maggots and turn the manure into compost and the process is repeated in different piles around the property. Then when the maggots are almost all eaten throw a few hand fulls of worms into the manure and watch your compost ready for gardening.

Very impressive sir dexter.. I ❤️❤️ watching your vlogs... more power and God bless!

Hi Mr.Dexter...hats off...keep up your super informative work.

You have some friends in Greece to!!

If you remove all the kits at once doesn't it put the mother at risk for mastitis? Going from full milk production to no release of milk at without a slow decline can put the mom at health risk. I would really leave one or two smaller kits on her for another week or two after removing majority of litter just so she can have the natural weaning process occur.

dexter - how do you ensure that the soil you use for their burrows is correct type Like pH value, germ/decease free, optimal moisture content etc things